| Clone Name | bast12e11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CIC_DROME (Q9U1H0) Putative transcription factor capicua (Protei... | 28 | 4.2 | 2 | TRPB_RHOS4 (Q9X4E5) Tryptophan synthase beta chain (EC 4.2.1.20) | 28 | 4.2 | 3 | TRPB_XANAC (Q8PJ28) Tryptophan synthase beta chain (EC 4.2.1.20) | 28 | 5.5 | 4 | SOLI2_RALSO (O30920) Autoinducer synthesis protein solI | 27 | 9.4 |
|---|
>CIC_DROME (Q9U1H0) Putative transcription factor capicua (Protein fettucine)| Length = 1403 Score = 28.5 bits (62), Expect = 4.2 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +2 Query: 161 IHAPQLRQQCLRVQHRHRVPRPAAQA-LPA 247 +HAP +QQ L+ QH H P P A LPA Sbjct: 153 MHAPPPQQQPLQQQHHHHQPPPPPPASLPA 182
>TRPB_RHOS4 (Q9X4E5) Tryptophan synthase beta chain (EC 4.2.1.20)| Length = 409 Score = 28.5 bits (62), Expect = 4.2 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +3 Query: 246 LRDAYDDMLLDGVQPVRDTFHSLIVGTMKG 335 L+DA +D L D V VRDTF+ +GT+ G Sbjct: 177 LKDAMNDALRDWVTNVRDTFY--CIGTVAG 204
>TRPB_XANAC (Q8PJ28) Tryptophan synthase beta chain (EC 4.2.1.20)| Length = 405 Score = 28.1 bits (61), Expect = 5.5 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +3 Query: 246 LRDAYDDMLLDGVQPVRDTFHSLIVGTMKG 335 L+DA ++ + D V VRDTF+ I+GT+ G Sbjct: 177 LKDALNEAMRDWVTNVRDTFY--IIGTVAG 204
>SOLI2_RALSO (O30920) Autoinducer synthesis protein solI| Length = 204 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +3 Query: 195 EYNTVIGS--LVQQRRPYLLRDAYDDMLLDGVQP 290 E T+ G L+ RPYLL+D + +L+ G+ P Sbjct: 60 EGGTICGCARLLPTTRPYLLKDVFASLLMHGMPP 93 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,067,967 Number of Sequences: 219361 Number of extensions: 507336 Number of successful extensions: 1808 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1746 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1806 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)