| Clone Name | bast11h04 |
|---|---|
| Clone Library Name | barley_pub |
>HQGT_ARATH (Q9M156) Probable hydroquinone glucosyltransferase (EC 2.4.1.218)| (Arbutin synthase) Length = 480 Score = 44.7 bits (104), Expect = 7e-05 Identities = 21/36 (58%), Positives = 24/36 (66%) Frame = +3 Query: 123 SARPHVLLLCSPCMGHLIPFAELARRLVADHGLAAT 230 S PHV ++ SP MGHLIP E A+RLV HGL T Sbjct: 4 SKTPHVAIIPSPGMGHLIPLVEFAKRLVHLHGLTVT 39
>HQGT_RAUSE (Q9AR73) Hydroquinone glucosyltransferase (EC 2.4.1.218) (Arbutin| synthase) Length = 470 Score = 39.3 bits (90), Expect = 0.003 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +3 Query: 132 PHVLLLCSPCMGHLIPFAELARRLVADHGLAAT 230 PH+ ++ +P MGHLIP E A+RLV H T Sbjct: 5 PHIAMVPTPGMGHLIPLVEFAKRLVLRHNFGVT 37
>UFOG5_MANES (Q40287) Anthocyanidin 3-O-glucosyltransferase (EC 2.4.1.115)| (Flavonol 3-O-glucosyltransferase 5) (UDP-glucose flavonoid 3-O-glucosyltransferase 5) Length = 487 Score = 38.9 bits (89), Expect = 0.004 Identities = 15/28 (53%), Positives = 23/28 (82%) Frame = +3 Query: 123 SARPHVLLLCSPCMGHLIPFAELARRLV 206 +++PH++LL SP +GHLIP EL +R+V Sbjct: 7 NSKPHIVLLSSPGLGHLIPVLELGKRIV 34
>ATG1_COLLN (P87248) Serine/threonine-protein kinase ATG1 (EC 2.7.11.1)| (Autophagy-related protein 1) (Colletotrichum lindemuthianum kinase 1) Length = 675 Score = 32.0 bits (71), Expect = 0.44 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 73 RTEPWEASQVTRSRRRRAHGHTCCSCAARAWGTSS 177 R +P A Q+ + + R H H C S A+R+ TSS Sbjct: 530 RMQPSSAVQIAQGKGRPGHDHPCVSLASRSLNTSS 564
>IAAG_MAIZE (Q41819) Indole-3-acetate beta-glucosyltransferase (EC 2.4.1.121)| (IAA-Glu synthetase) ((Uridine 5'-diphosphate-glucose:indol-3-ylacetyl)-beta-D-glucosyl transferase) Length = 471 Score = 30.8 bits (68), Expect = 0.99 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +3 Query: 132 PHVLLLCSPCMGHLIPFAELARRLVADHGLAAT 230 PHVL++ P GH+ P + A+RL A G+A T Sbjct: 3 PHVLVVPFPGQGHMNPMVQFAKRL-ASKGVATT 34
>WDR17_HUMAN (Q8IZU2) WD-repeat protein 17| Length = 1322 Score = 30.0 bits (66), Expect = 1.7 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +3 Query: 69 TTYGAMGGESGHQEPSPASARPHVLLLCSPCMGHLIPFAELARRLVAD 212 T G + H + + ++ +C PC+G+ +PF + R L AD Sbjct: 994 TVLGESAAPATHYALELLARKCMMISVCFPCVGYSVPFCYVNRNLAAD 1041
>SYT8_MOUSE (Q9R0N6) Synaptotagmin-8 (Synaptotagmin VIII) (SytVIII)| Length = 395 Score = 29.3 bits (64), Expect = 2.9 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = -3 Query: 132 AVRSPATAPGDLTRLPWLRTW*FADDRAVGG-QGECLLCFGCC 7 A P+ P +TR+PW R F A G CLLC CC Sbjct: 24 ATAGPSLIPDLITRIPWPRWTLFIAILAAGVLLVSCLLCVICC 66
>TCFL5_HUMAN (Q9UL49) Transcription factor-like 5 protein (Cha transcription| factor) (HPV-16 E2-binding protein 1) (E2BP-1) Length = 452 Score = 28.9 bits (63), Expect = 3.7 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = +3 Query: 81 AMGGESGHQEPSPASARPHVLLLCSPCMGHLIPFAELARRLVADHGLA 224 A GG+ G P P L +PC+GH I F EL L+++ G A Sbjct: 47 AAGGQGGAAPVYPVLC-PSALAADAPCLGH-IDFQELRMMLLSEAGAA 92
>JHD3D_HUMAN (Q6B0I6) JmjC domain-containing histone demethylation protein 3D| (EC 1.14.11.-) (Jumonji domain-containing protein 2D) Length = 520 Score = 28.9 bits (63), Expect = 3.7 Identities = 19/50 (38%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +2 Query: 5 QQQPKH-NKHSPWPPTARSSANXXXXXXXXXXXXPGAVAGERTATRAAPV 151 +Q P H +HSPWP ARS AV+G T RAA V Sbjct: 372 RQLPSHWARHSPWPMAARSGTRCHTLVCSSLPRR-SAVSGTATQPRAAAV 420
>TRI27_HUMAN (P14373) Zinc-finger protein RFP (Ret finger protein) (Tripartite| motif protein 27) (RING finger protein 76) Length = 513 Score = 28.9 bits (63), Expect = 3.7 Identities = 11/21 (52%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = +1 Query: 130 GHT-CCSCAARAWGTSSLSPS 189 GH CC+C AR WGT+ + S Sbjct: 32 GHNICCACLARCWGTAETNVS 52
>GIT2_HUMAN (Q14161) ARF GTPase-activating protein GIT2 (G protein-coupled| receptor kinase-interactor 2) (GRK-interacting protein 2) (Cool-interacting tyrosine-phosphorylated protein 2) (CAT2) (CAT-2) Length = 759 Score = 28.1 bits (61), Expect = 6.4 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 11 QPKHNKHSPWPPT 49 Q +H KH+PWPPT Sbjct: 47 QVRHLKHTPWPPT 59
>HIS8_NOCFA (Q5YYP9) Histidinol-phosphate aminotransferase (EC 2.6.1.9)| (Imidazole acetol-phosphate transaminase) Length = 385 Score = 27.7 bits (60), Expect = 8.3 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +3 Query: 102 HQEPSPASARPHVLLLCSPC--MGHLIPFAELARRLVADHGL 221 H + A RP V+ + SP GH IP A+LAR L A G+ Sbjct: 159 HAVATIAERRPDVVFVTSPNNPTGHSIPGADLARILDAAPGI 200
>FTSK_TREPA (O83964) DNA translocase ftsK| Length = 799 Score = 27.7 bits (60), Expect = 8.3 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +3 Query: 69 TTYGAMGGESGHQEPSPASARPHVLLLCSPCMGHLIPF 182 T A E G P PASA P L PC G+ +P+ Sbjct: 306 TLIPAQDDEQGPPRPIPASAAP----LRHPCRGYQVPY 339 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.313 0.120 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,479,835 Number of Sequences: 219361 Number of extensions: 514435 Number of successful extensions: 2151 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2083 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2149 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)