| Clone Name | bast11d07 |
|---|---|
| Clone Library Name | barley_pub |
>APG_BRANA (P40603) Anter-specific proline-rich protein APG (Protein CEX)| (Fragment) Length = 449 Score = 55.1 bits (131), Expect = 5e-08 Identities = 25/45 (55%), Positives = 30/45 (66%) Frame = +1 Query: 121 VPAIIVFGDSSVDTGNNNFIPTIARSNFWPYGRDFADGHPTGRFS 255 +PA+ FGDS DTGNNN + T + N+ PYG DF G TGRFS Sbjct: 123 IPAVFFFGDSIFDTGNNNNLDTKLKCNYRPYGMDFPMGVATGRFS 167
>APG_ARATH (P40602) Anter-specific proline-rich protein APG precursor| Length = 534 Score = 53.9 bits (128), Expect = 1e-07 Identities = 25/45 (55%), Positives = 30/45 (66%) Frame = +1 Query: 121 VPAIIVFGDSSVDTGNNNFIPTIARSNFWPYGRDFADGHPTGRFS 255 +PA+ FGDS DTGNNN + T +SN+ PYG DF TGRFS Sbjct: 202 IPAVFFFGDSVFDTGNNNNLETKIKSNYRPYGMDFKFRVATGRFS 246
>FTSH4_SYNY3 (P72991) Cell division protein ftsH homolog 4 (EC 3.4.24.-)| Length = 616 Score = 30.0 bits (66), Expect = 1.6 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 100 AVAAAGKVPAIIVFGDSSVDTGNNNFIPTIAR 195 AVA G++ I+FG+ V TG +N + +AR Sbjct: 479 AVALGGRIAEEIIFGEEEVTTGASNDLQQVAR 510
>FTSH1_ARATH (Q39102) Cell division protein ftsH homolog 1, chloroplast| precursor (EC 3.4.24.-) Length = 716 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 100 AVAAAGKVPAIIVFGDSSVDTGNNNFIPTIAR 195 AVA G+V ++FGD +V TG +N ++R Sbjct: 580 AVALGGRVAEEVIFGDENVTTGASNDFMQVSR 611
>CRM_DROSE (Q8MX88) Protein cramped| Length = 975 Score = 29.6 bits (65), Expect = 2.1 Identities = 18/72 (25%), Positives = 33/72 (45%) Frame = -2 Query: 233 PSAKSRPYGQKLLRAMVGMKLLLPVSTDESPNTMIAGTLPAAATAVGXXXXXXXXPSTRR 54 P ++ P L AMV + + +P+T+++G+L A + A + + Sbjct: 504 PVLQAYPASADLSHAMVTSVIQTTCAAAPAPSTLVSGSLTAPSVARSKRKEAKEAAAAAQ 563 Query: 53 IRHGRYLWSDDI 18 R+ + L SDDI Sbjct: 564 ARNFKPLLSDDI 575
>FTSH2_ARATH (Q9FH02) Cell division protein ftsH homolog 2, chloroplast| precursor (EC 3.4.24.-) Length = 704 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 100 AVAAAGKVPAIIVFGDSSVDTGNNNFIPTIAR 195 AVA G+V ++FGD +V TG +N ++R Sbjct: 568 AVALGGRVAEEVIFGDENVTTGASNDFMQVSR 599
>FTSH_CAPAN (Q39444) Cell division protein ftsH homolog, chloroplast precursor| (EC 3.4.24.-) (Fragment) Length = 662 Score = 28.1 bits (61), Expect = 6.2 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 100 AVAAAGKVPAIIVFGDSSVDTGNNNFIPTIAR 195 AVA G+V ++FG+ +V TG +N ++R Sbjct: 548 AVALGGRVAEEVIFGEDNVTTGASNDFMQVSR 579
>GUN2_THEFU (P26222) Endoglucanase E-2 precursor (EC 3.2.1.4)| (Endo-1,4-beta-glucanase E-2) (Cellulase E-2) (Cellulase E2) Length = 441 Score = 27.7 bits (60), Expect = 8.1 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +1 Query: 97 TAVAAAGKVPAIIVFGDSSVDTGNNNFIPTIARSNFWPYGRDFADG 234 +A AAGK+P ++V+ D GN++ + S + + +FA G Sbjct: 90 SAAQAAGKIPILVVYNAPGRDCGNHSSGGAPSHSAYRSWIDEFAAG 135 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,149,754 Number of Sequences: 219361 Number of extensions: 343791 Number of successful extensions: 1233 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1213 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1233 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)