| Clone Name | bast10h11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UCRI_MAIZE (P49727) Ubiquinol-cytochrome c reductase iron-sulfur... | 63 | 2e-10 | 2 | GPTC2_HUMAN (Q9NW75) G patch domain-containing protein 2 | 28 | 4.4 | 3 | GPTC2_MOUSE (Q7TQC7) G patch domain-containing protein 2 | 28 | 7.5 | 4 | SCNA_ELEEL (P02719) Sodium channel protein (Na(+) channel) | 27 | 9.8 |
|---|
>UCRI_MAIZE (P49727) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 273 Score = 62.8 bits (151), Expect = 2e-10 Identities = 34/62 (54%), Positives = 37/62 (59%) Frame = +1 Query: 133 MLRVAGRRLSSSLSWRPAATVXXXXXXXXXXXXXXXXXXXXXYQRRFAIESPFFTAARGF 312 MLRVAGRRLSSSLSWRPAA V Q RF+I+SPFF A+RGF Sbjct: 1 MLRVAGRRLSSSLSWRPAAAVARGPLAGAGVPDRDDDSARGRSQPRFSIDSPFFVASRGF 60 Query: 313 SS 318 SS Sbjct: 61 SS 62
>GPTC2_HUMAN (Q9NW75) G patch domain-containing protein 2| Length = 528 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = +1 Query: 70 PSRD*TTIPNLSEEDEDDADEMLRVAGRRLSSSLS 174 PS+D N +++D D+D+ + VA RR SS+L+ Sbjct: 99 PSKDYRENHNNNKKDHSDSDDQMLVAKRRPSSNLN 133
>GPTC2_MOUSE (Q7TQC7) G patch domain-containing protein 2| Length = 527 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = +1 Query: 70 PSRD*TTIPNLSEEDEDDADEMLRVAGRRLSSSLS 174 PS+D + +++D D+D+ + VA RR SS+LS Sbjct: 98 PSKDYREKHSNNKKDRSDSDDQMLVAKRRPSSNLS 132
>SCNA_ELEEL (P02719) Sodium channel protein (Na(+) channel)| Length = 1820 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 97 NLSEEDEDDADEMLRVAGRRLSSSLSW 177 NLS +EDD L+VA R+S + +W Sbjct: 797 NLSSIEEDDEVNSLQVASERISRAKNW 823 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,880,550 Number of Sequences: 219361 Number of extensions: 195993 Number of successful extensions: 606 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 604 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)