| Clone Name | bast08a09 |
|---|---|
| Clone Library Name | barley_pub |
>CB4B_ARATH (Q9XF88) Chlorophyll a-b binding protein CP29.2, chloroplast| precursor (LHCII protein 4.2) (LHCB4.2) Length = 287 Score = 79.0 bits (193), Expect = 3e-15 Identities = 38/70 (54%), Positives = 48/70 (68%), Gaps = 1/70 (1%) Frame = +1 Query: 103 TFLGTRL-ADPAPQNGRIVARFGFGXXXXXXXXXXXXXTTDRPLWFPGAQAPEYLDGTLV 279 + +GTR+ +D + + R ARFGFG + DRPLWFPGA++PEYLDG+LV Sbjct: 12 SIMGTRVVSDISSNSSRFTARFGFGTKKASPKKAKTVIS-DRPLWFPGAKSPEYLDGSLV 70 Query: 280 GDYGFDPFGL 309 GDYGFDPFGL Sbjct: 71 GDYGFDPFGL 80
>CB4A_ARATH (Q07473) Chlorophyll a-b binding protein CP29.1, chloroplast| precursor (LHCII protein 4.1) (LHCB4.1) Length = 290 Score = 76.6 bits (187), Expect = 1e-14 Identities = 38/71 (53%), Positives = 47/71 (66%), Gaps = 2/71 (2%) Frame = +1 Query: 103 TFLGTRLADPA-PQNGRIVARFGFGXXXXX-XXXXXXXXTTDRPLWFPGAQAPEYLDGTL 276 + +GTR+A P +GR A FGFG TTDRPLW+PGA +P++LDG+L Sbjct: 13 SIMGTRVAPGIHPGSGRFTAVFGFGKKKAAPKKSAKKTVTTDRPLWYPGAISPDWLDGSL 72 Query: 277 VGDYGFDPFGL 309 VGDYGFDPFGL Sbjct: 73 VGDYGFDPFGL 83
>CB4C_ARATH (Q9S7W1) Chlorophyll a-b binding protein CP29.3, chloroplast| precursor (LHCII protein 4.3) (LHCB4.3) Length = 276 Score = 68.2 bits (165), Expect = 5e-12 Identities = 33/71 (46%), Positives = 40/71 (56%), Gaps = 5/71 (7%) Frame = +1 Query: 112 GTRLADPAPQNGRIVARFGFGXXXXXXX-----XXXXXXTTDRPLWFPGAQAPEYLDGTL 276 G R+ DP P GR+ ARFGF DR +WFPGA PE+LDG++ Sbjct: 14 GIRIQDPRPGTGRVQARFGFSFGKKKPAPPPKKSRQVQDDGDRLVWFPGANPPEWLDGSM 73 Query: 277 VGDYGFDPFGL 309 +GD GFDPFGL Sbjct: 74 IGDRGFDPFGL 84
>CB12_PETHY (P13869) Chlorophyll a-b binding protein, chloroplast precursor| (LHCI type II CAB) Length = 270 Score = 56.2 bits (134), Expect = 2e-08 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +1 Query: 220 DRPLWFPGAQAPEYLDGTLVGDYGFDPFGL 309 DRPLWFPG+ PE+LDG+L GD+GFDP GL Sbjct: 64 DRPLWFPGSTPPEWLDGSLPGDFGFDPLGL 93
>CB12_LYCES (P10708) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCI type II CAB-7) Length = 270 Score = 53.9 bits (128), Expect = 1e-07 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = +1 Query: 220 DRPLWFPGAQAPEYLDGTLVGDYGFDPFGL 309 DRPLWFPG+ P +LDG+L GD+GFDP GL Sbjct: 64 DRPLWFPGSTPPPWLDGSLPGDFGFDPLGL 93
>CB13_LYCES (P27522) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCI type III CAB-8) Length = 273 Score = 43.5 bits (101), Expect = 1e-04 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +1 Query: 220 DRPLWFPGAQAPEYLDGTLVGDYGFDPFGL 309 +R LWF Q+ YLDG L GD+GFDP GL Sbjct: 52 NRQLWFASKQSLSYLDGRLPGDFGFDPLGL 81
>CB24_ARATH (P27521) Chlorophyll a-b binding protein 4, chloroplast precursor| (LHCI type III CAB-4) (LHCP) Length = 251 Score = 42.7 bits (99), Expect = 2e-04 Identities = 19/56 (33%), Positives = 25/56 (44%) Frame = +1 Query: 142 NGRIVARFGFGXXXXXXXXXXXXXTTDRPLWFPGAQAPEYLDGTLVGDYGFDPFGL 309 +GR+ F + W PG +P+YL G+L GD GFDP GL Sbjct: 27 SGRLNRDLSFTSIGSSAKTSSFKVEAKKGEWLPGLASPDYLTGSLAGDNGFDPLGL 82
>CB29_CHLRE (Q93WD2) Chlorophyll a-b binding protein CP29| Length = 279 Score = 42.4 bits (98), Expect = 3e-04 Identities = 17/27 (62%), Positives = 19/27 (70%) Frame = +1 Query: 229 LWFPGAQAPEYLDGTLVGDYGFDPFGL 309 LW P PE+LDG+L GD GFDP GL Sbjct: 51 LWLPNTTRPEWLDGSLPGDRGFDPLGL 77
>LH18_EUGGR (P08976) Light-harvesting complex I LH38 proteins precursor| [Contains: LH38 protein 1; LH38 protein 2; LH38 protein 3] (Fragment) Length = 530 Score = 42.0 bits (97), Expect = 4e-04 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = +1 Query: 226 PLWFPGAQAPEYLDGTLVGDYGFDPFGL 309 PLWFP AP +L+G GD GFDP GL Sbjct: 3 PLWFPNTLAPSWLNGEYYGDRGFDPAGL 30 Score = 40.4 bits (93), Expect = 0.001 Identities = 17/30 (56%), Positives = 18/30 (60%) Frame = +1 Query: 220 DRPLWFPGAQAPEYLDGTLVGDYGFDPFGL 309 +R LWFP P YL G GD GFDP GL Sbjct: 370 ERELWFPNIVPPRYLTGEAYGDKGFDPAGL 399 Score = 33.9 bits (76), Expect = 0.11 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 Query: 229 LWFPGAQAPEYLDGTLVGDYGFDPFGL 309 LWFP A+ P L G D GFDP L Sbjct: 189 LWFPNAEPPALLTGEYPADRGFDPLNL 215
>CB11_LYCES (P12360) Chlorophyll a-b binding protein 6A, chloroplast precursor| (LHCI type I CAB-6A) (Light-harvesting complex I 26 kDa protein) Length = 246 Score = 39.7 bits (91), Expect = 0.002 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +1 Query: 232 WFPGAQAPEYLDGTLVGDYGFDPFGL 309 W PG P YLDG+ GD+GFD GL Sbjct: 49 WMPGQPRPSYLDGSAPGDFGFDSLGL 74
>CB26_ARATH (Q9XF89) Chlorophyll a-b binding protein CP26, chloroplast| precursor (Light-harvesting complex II protein 5) (LHCB5) (LHCIIc) Length = 280 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/35 (48%), Positives = 24/35 (68%), Gaps = 5/35 (14%) Frame = +1 Query: 220 DRPLWFPG-----AQAPEYLDGTLVGDYGFDPFGL 309 DR ++ P ++ PEYL+G + GDYG+DPFGL Sbjct: 66 DRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDPFGL 100
>CB4A_LYCES (P27524) Chlorophyll a-b binding protein CP24 10A, chloroplast| precursor (CAB-10A) (LHCP) Length = 256 Score = 38.9 bits (89), Expect = 0.003 Identities = 17/32 (53%), Positives = 20/32 (62%), Gaps = 6/32 (18%) Frame = +1 Query: 232 WFPGAQA------PEYLDGTLVGDYGFDPFGL 309 W P + PE+LDG+L GDYGFDP GL Sbjct: 55 WIPAVRGGGNLVDPEWLDGSLPGDYGFDPLGL 86
>CB4B_LYCES (P27525) Chlorophyll a-b binding protein CP24 10B, chloroplast| precursor (CAB-10B) (LHCP) Length = 256 Score = 37.7 bits (86), Expect = 0.007 Identities = 16/32 (50%), Positives = 21/32 (65%), Gaps = 6/32 (18%) Frame = +1 Query: 232 WFPGAQA------PEYLDGTLVGDYGFDPFGL 309 W P ++ PE+LDG+L GD+GFDP GL Sbjct: 55 WIPAVKSGGNLVDPEWLDGSLPGDFGFDPLGL 86
>CB4_SPIOL (P36494) Chlorophyll a-b binding protein CP24, chloroplast| precursor Length = 261 Score = 37.4 bits (85), Expect = 0.010 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 6/32 (18%) Frame = +1 Query: 232 WFPGAQA------PEYLDGTLVGDYGFDPFGL 309 W P + PE+LDG+L GD+GFDP GL Sbjct: 60 WIPAVKGGGNFLDPEWLDGSLPGDFGFDPLGL 91
>LH15_EUGGR (P08975) Light-harvesting complex I LH35 proteins precursor| [Contains: LH35 protein 1; LH35 protein 2] (Fragment) Length = 331 Score = 36.2 bits (82), Expect = 0.021 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +1 Query: 229 LWFPGAQAPEYLDGTLVGDYGFDPFGL 309 +WFPGAQ P +L G D GFDP + Sbjct: 161 VWFPGAQPPAHLTGEYPADRGFDPLSV 187
>VNUA_PRVKA (P33485) Probable nuclear antigen| Length = 1733 Score = 33.9 bits (76), Expect = 0.11 Identities = 21/53 (39%), Positives = 23/53 (43%) Frame = +3 Query: 12 RHPNARKGRGGQS*EERVSSHGFVGGRRGEHVPRDPAGGPGAAERAHRGAVRL 170 R R GRGG+ GR G PR GGPG RA RG VR+ Sbjct: 1442 RGRGGRGGRGGR-------------GRGGGRAPRGGGGGPGGGGRAGRGEVRV 1481
>CB2_MALDO (P15773) Chlorophyll a-b binding protein AB10, chloroplast| precursor (LHCII type I CAB-AB10) (LHCP) Length = 268 Score = 32.0 bits (71), Expect = 0.40 Identities = 20/70 (28%), Positives = 30/70 (42%), Gaps = 6/70 (8%) Frame = +1 Query: 118 RLADPA---PQNGRIVARFGFGXXXXXXXXXXXXXTTDRPLWFPG---AQAPEYLDGTLV 279 ++A P+ P + ++ GF T DR + + G + P YL G Sbjct: 19 KIAKPSKLNPISSTLIVTAGFTMLKHAAKSKVSSSTCDRRVKYLGPFSGEWPSYLTGEFP 78 Query: 280 GDYGFDPFGL 309 GDYG+D GL Sbjct: 79 GDYGWDTAGL 88
>CB23_HORVU (P27523) Chlorophyll a-b binding protein of LHCII type III,| chloroplast precursor (CAB) Length = 268 Score = 31.6 bits (70), Expect = 0.53 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +1 Query: 244 AQAPEYLDGTLVGDYGFDPFGL 309 AQ P YL+G GDYG+D GL Sbjct: 64 AQTPSYLNGEFPGDYGWDTAGL 85
>CB23_POLMU (P15195) Chlorophyll a-b binding protein type 1 member F3,| chloroplast precursor (DE Chlorophyll a-b binding protein type I F3) (CAB-F3) (LHCP) Length = 265 Score = 31.6 bits (70), Expect = 0.53 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = +1 Query: 217 TDRPLW---FPGAQAPEYLDGTLVGDYGFDPFGL 309 +DRPL+ F G+ P YL G GDYG+D GL Sbjct: 52 SDRPLYLGPFSGSP-PSYLSGEFPGDYGWDTAGL 84
>CB23_LYCES (P27489) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type III CAB-13) Length = 265 Score = 31.6 bits (70), Expect = 0.53 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +1 Query: 244 AQAPEYLDGTLVGDYGFDPFGL 309 AQ P YL+G GDYG+D GL Sbjct: 61 AQTPSYLNGEFPGDYGWDTAGL 82
>CB2A_PINSY (P15193) Chlorophyll a-b binding protein type 2 member 1A,| chloroplast precursor (Chlorophyll a-b binding protein type II 1A) (CAB) (LHCP) Length = 278 Score = 30.8 bits (68), Expect = 0.90 Identities = 23/82 (28%), Positives = 29/82 (35%), Gaps = 14/82 (17%) Frame = +1 Query: 106 FLGTRLADPAPQNG------------RIVARFGFGXXXXXXXXXXXXXTTDRPLWFP--G 243 F G +L+ PQN R+ R G DR L+ Sbjct: 16 FAGAQLSSVKPQNNQLLGVGGAHGEARLTMRKATGKKSVAASIDSPWYGPDRVLYLGPFS 75 Query: 244 AQAPEYLDGTLVGDYGFDPFGL 309 + P YL G GDYG+D GL Sbjct: 76 GEPPSYLTGEFPGDYGWDTAGL 97
>COHA1_HUMAN (Q9UMD9) Collagen alpha-1(XVII) chain (Bullous pemphigoid antigen| 2) (180 kDa bullous pemphigoid antigen 2) Length = 1497 Score = 30.8 bits (68), Expect = 0.90 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +3 Query: 18 PNARKGRGGQS*EERVSSHGFVGGRRGEHVPRDPAGGPGAAERAHRGA 161 P KG+ G + + GR G PR AG PG+ E+ RGA Sbjct: 601 PQGPKGQKGSVGDPGMEGPMGQRGREGPMGPRGEAGPPGSGEKGERGA 648
>CB23_ORYSA (P27519) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 263 Score = 30.4 bits (67), Expect = 1.2 Identities = 24/77 (31%), Positives = 29/77 (37%), Gaps = 8/77 (10%) Frame = +1 Query: 103 TFLGTRLADPAPQNGRIVARFGFGXXXXXXXXXXXXXTT------DRPLWFP--GAQAPE 258 +FLGT AP+ +V R G DRP + Q P Sbjct: 11 SFLGT-----APRRDELVRRVGDSGGRITMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPS 65 Query: 259 YLDGTLVGDYGFDPFGL 309 YL G GDYG+D GL Sbjct: 66 YLTGEFPGDYGWDTAGL 82
>CB2_PHYPA (P20866) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 269 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +1 Query: 220 DRPLWFP--GAQAPEYLDGTLVGDYGFDPFGL 309 DRP + + P YL+G GDYG+D GL Sbjct: 56 DRPKFLGPFSGETPSYLNGEFAGDYGWDTAGL 87
>CB2A_PYRPY (P24006) Chlorophyll a-b binding protein 1A, chloroplast precursor| (LHCII type II CAB-1A) (LHCP) Length = 278 Score = 30.0 bits (66), Expect = 1.5 Identities = 22/82 (26%), Positives = 29/82 (35%), Gaps = 14/82 (17%) Frame = +1 Query: 106 FLGTRLADPAPQNG------------RIVARFGFGXXXXXXXXXXXXXTTDRPLWFP--G 243 F G +L+ PQN R+ R G DR ++ Sbjct: 16 FAGAQLSSVKPQNNQLLGVGGAHGEARLTMRKATGRKSVAASIDSPWYGPDRVMYLGPFS 75 Query: 244 AQAPEYLDGTLVGDYGFDPFGL 309 + P YL G GDYG+D GL Sbjct: 76 GEPPSYLTGEFPGDYGWDTAGL 97
>CO3A1_MOUSE (P08121) Collagen alpha-1(III) chain precursor| Length = 1464 Score = 30.0 bits (66), Expect = 1.5 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = +3 Query: 30 KGRGGQS*EERVSSHGFVGGRRGEHVPRDPAGGPGA 137 KG GG ++ G RGEH P PAG PGA Sbjct: 778 KGEGGSPGLPGIAGPRGGPGERGEHGPPGPAGFPGA 813
>CB26_PETSP (P12062) Chlorophyll a-b binding protein 37, chloroplast precursor| (LHCII type I CAB-37) (LHCP) Length = 265 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +1 Query: 220 DRPLWFP--GAQAPEYLDGTLVGDYGFDPFGL 309 DRP + Q P YL G GDYG+D GL Sbjct: 53 DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGL 84
>CB24_LYCES (P14278) Chlorophyll a-b binding protein 4, chloroplast precursor| (LHCII type I CAB-4) (LHCP) Length = 265 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +1 Query: 220 DRPLWFP--GAQAPEYLDGTLVGDYGFDPFGL 309 DRP + Q P YL G GDYG+D GL Sbjct: 53 DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGL 84
>CB23_TOBAC (P27494) Chlorophyll a-b binding protein 36, chloroplast precursor| (LHCII type I CAB-36) (LHCP) Length = 265 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +1 Query: 220 DRPLWFP--GAQAPEYLDGTLVGDYGFDPFGL 309 DRP + Q P YL G GDYG+D GL Sbjct: 53 DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGL 84
>CB21_SILPR (P12332) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) (Fragment) Length = 205 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +1 Query: 220 DRPLWFP--GAQAPEYLDGTLVGDYGFDPFGL 309 DRP + Q P YL G GDYG+D GL Sbjct: 52 DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGL 83
>CB25_LYCES (P14279) Chlorophyll a-b binding protein 5, chloroplast precursor| (LHCII type I CAB-5) (LHCP) (Fragment) Length = 237 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +1 Query: 220 DRPLWFP--GAQAPEYLDGTLVGDYGFDPFGL 309 DRP + Q P YL G GDYG+D GL Sbjct: 25 DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGL 56
>CO3A1_RAT (P13941) Collagen alpha-1(III) chain precursor| Length = 1463 Score = 29.6 bits (65), Expect = 2.0 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = +3 Query: 30 KGRGGQS*EERVSSHGFVGGRRGEHVPRDPAGGPGA 137 KG GG ++ G RGEH P PAG PGA Sbjct: 778 KGEGGAPGLPGIAGPRGGPGERGEHGPPGPAGFPGA 813
>CB2_DUNTE (P27517) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 253 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 Query: 235 FPGAQAPEYLDGTLVGDYGFDPFGL 309 F PEYL G GDYG+D GL Sbjct: 45 FSENDTPEYLTGEFPGDYGWDTAGL 69
>HNRL1_MOUSE (Q8VDM6) Heterogeneous nuclear ribonucleoprotein U-like protein 1| Length = 859 Score = 29.6 bits (65), Expect = 2.0 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +3 Query: 30 KGRGGQS*EERVSSHGFVGGRRGEHVPRDPAGGPGAAERAHRG 158 +GRGG +R + G GG RG R GG G +RG Sbjct: 618 RGRGGGGGFQRYDNRGPPGGNRGGFQNRGGGGGSGGGGGNYRG 660
>CB23_PEA (P27520) Chlorophyll a-b binding protein 215, chloroplast precursor| (LHCII type II CAB-215) (LHCP) Length = 265 Score = 29.6 bits (65), Expect = 2.0 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +1 Query: 220 DRPLWFP--GAQAPEYLDGTLVGDYGFDPFGL 309 DRP + Q P YL G GDYG+D GL Sbjct: 53 DRPKYLGPFSEQIPSYLTGEFPGDYGWDTAGL 84
>CB23_APIGR (P92919) Chlorophyll a-b binding protein, chloroplast precursor| (Allergen Api g 3) Length = 264 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 +AP YL G GDYG+D GL Sbjct: 63 EAPSYLTGEFPGDYGWDTAGL 83
>CB21_LEMGI (P12328) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 264 Score = 29.6 bits (65), Expect = 2.0 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +1 Query: 220 DRPLWFP--GAQAPEYLDGTLVGDYGFDPFGL 309 DRP + Q P YL G GDYG+D GL Sbjct: 52 DRPKFLGPFSEQTPSYLTGEFPGDYGWDTAGL 83
>CB27_TOBAC (P27491) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCII type I CAB-7) (LHCP) Length = 267 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 +AP YL G GDYG+D GL Sbjct: 66 EAPSYLTGEFPGDYGWDTAGL 86
>CB24_PETSP (P04782) Chlorophyll a-b binding protein 25, chloroplast precursor| (LHCII type I CAB-25) (LHCP) Length = 266 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 +AP YL G GDYG+D GL Sbjct: 65 EAPSYLTGEFPGDYGWDTAGL 85
>CB22_PETSP (P04780) Chlorophyll a-b binding protein 22L, chloroplast precursor| (LHCII type I CAB-22L) (LHCP) Length = 267 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 +AP YL G GDYG+D GL Sbjct: 66 EAPSYLTGEFPGDYGWDTAGL 86
>CB21_PETSP (P04779) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type I CAB-13) (LHCP) Length = 266 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 +AP YL G GDYG+D GL Sbjct: 65 EAPSYLTGEFPGDYGWDTAGL 85
>CO6A3_CHICK (P15989) Collagen alpha-3(VI) chain precursor| Length = 3137 Score = 29.3 bits (64), Expect = 2.6 Identities = 20/49 (40%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = +3 Query: 21 NARKGRGGQS*EERVSSHGFVG--GRRGEHVPRDPAGGPG-AAERAHRG 158 + R G GG + R GFVG G +G R AGGPG R RG Sbjct: 2301 DGRDGIGGPGPKGRKGERGFVGYPGPKGGPGDRGGAGGPGPKGNRGRRG 2349
>CB21_GOSHI (P27518) Chlorophyll a-b binding protein 151, chloroplast precursor| (LHCII type II CAB-151) (LHCP) Length = 265 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +1 Query: 220 DRPLWFP--GAQAPEYLDGTLVGDYGFDPFGL 309 DRP + Q P YL G GDYG+D GL Sbjct: 53 DRPKYLGPFSDQIPSYLTGEFPGDYGWDTAGL 84
>PP1RA_RAT (O55000) Serine/threonine-protein phosphatase 1 regulatory subunit| 10 (Phosphatase 1 nuclear targeting subunit) (PNUTS protein) (MHC class I region proline-rich protein CAT53) Length = 872 Score = 28.9 bits (63), Expect = 3.4 Identities = 19/48 (39%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +3 Query: 18 PNARKGRGGQS*EERVSSHGFVGGRRGEHVPRD-PAGGPGAAERAHRG 158 PN R G GG G VGG G H P + P G G+ R+H G Sbjct: 734 PNGRGGPGGG---------GMVGG--GGHRPHEGPGGSMGSGHRSHEG 770
>CB28_PEA (P27490) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCII type I CAB-8) Length = 268 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 ++P YL G GDYG+D GL Sbjct: 67 ESPSYLTGEFPGDYGWDTAGL 87
>CB2B_LYCES (P07370) Chlorophyll a-b binding protein 1B, chloroplast precursor| (LHCII type I CAB-1B) (LHCP) Length = 265 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 ++P YL G GDYG+D GL Sbjct: 64 ESPSYLTGEFPGDYGWDTAGL 84
>CB22_TOBAC (P27493) Chlorophyll a-b binding protein 21, chloroplast precursor| (LHCII type I CAB-21) (LHCP) Length = 265 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 ++P YL G GDYG+D GL Sbjct: 64 ESPSYLTGEFPGDYGWDTAGL 84
>CB22_HORVU (P08963) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 264 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 ++P YL G GDYG+D GL Sbjct: 63 ESPSYLTGEFPGDYGWDTAGL 83
>CB2_CHLMO (P22686) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 256 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +1 Query: 220 DRPLWFP--GAQAPEYLDGTLVGDYGFDPFGL 309 DR W P YL G GDYG+D GL Sbjct: 43 DRAKWLGPFSTNTPAYLTGEFPGDYGWDTAGL 74
>CB2G_LYCES (P07369) Chlorophyll a-b binding protein 3C, chloroplast precursor| (LHCII type I CAB-3C) (LHCP) Length = 267 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 ++P YL G GDYG+D GL Sbjct: 66 ESPSYLTGEFPGDYGWDTAGL 86
>CB2A_SPIOL (P12333) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 267 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 ++P YL G GDYG+D GL Sbjct: 66 ESPSYLTGEFPGDYGWDTAGL 86
>CB25_TOBAC (P27496) Chlorophyll a-b binding protein 50, chloroplast precursor| (LHCII type I CAB-50) (LHCP) Length = 267 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 ++P YL G GDYG+D GL Sbjct: 66 ESPSYLTGEFPGDYGWDTAGL 86
>CB24_TOBAC (P27495) Chlorophyll a-b binding protein 40, chloroplast precursor| (LHCII type I CAB-40) (LHCP) Length = 267 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 ++P YL G GDYG+D GL Sbjct: 66 ESPSYLTGEFPGDYGWDTAGL 86
>CB23_NICPL (P12469) Chlorophyll a-b binding protein C, chloroplast precursor| (LHCII type I CAB-C) (LHCP) Length = 267 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 ++P YL G GDYG+D GL Sbjct: 66 ESPSYLTGEFPGDYGWDTAGL 86
>CB22_ARATH (P04778) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (CAB-140) (LHCP) Length = 267 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 ++P YL G GDYG+D GL Sbjct: 65 ESPSYLTGEFPGDYGWDTAGL 85
>CB21_ARATH (P04777) Chlorophyll a-b binding protein 165/180, chloroplast| precursor (LHCII type I CAB-165/180) Length = 267 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 ++P YL G GDYG+D GL Sbjct: 65 ESPSYLTGEFPGDYGWDTAGL 85
>CB25_NICPL (P12470) Chlorophyll a-b binding protein E, chloroplast precursor| (LHCII type I CAB-E) (LHCP) Length = 266 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 ++P YL G GDYG+D GL Sbjct: 65 ESPSYLTGEFPGDYGWDTAGL 85
>CB22_PEA (P07371) Chlorophyll a-b binding protein AB80, chloroplast| precursor (LHCII type I CAB-AB80) (LHCP) Length = 269 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 ++P YL G GDYG+D GL Sbjct: 68 ESPSYLTGEFPGDYGWDTAGL 88
>CB21_TOBAC (P27492) Chlorophyll a-b binding protein 16, chloroplast precursor| (LHCII type I CAB-16) (LHCP) Length = 266 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 ++P YL G GDYG+D GL Sbjct: 65 ESPSYLTGEFPGDYGWDTAGL 85
>CB21_PEA (P04159) Chlorophyll a-b binding protein AB96 (LHCII type I| CAB-AB96) (LHCP) (Major 15) (Fragment) Length = 228 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 ++P YL G GDYG+D GL Sbjct: 27 ESPSYLTGEFPGDYGWDTAGL 47
>CB21_WHEAT (P04784) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 266 Score = 28.1 bits (61), Expect = 5.8 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = +1 Query: 217 TDRPLWFP--GAQAPEYLDGTLVGDYGFDPFGL 309 +DR L+ + P YL G GDYG+D GL Sbjct: 53 SDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGL 85
>CB22_ORYSA (P12331) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 261 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 + P YL G GDYG+D GL Sbjct: 60 EPPSYLTGEFPGDYGWDTAGL 80
>CB2B_PINSY (P15194) Chlorophyll a-b binding protein type 2 member 1B,| chloroplast precursor (Chlorophyll a-b binding protein type II 1B) (CAB) (LHCP) Length = 274 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 + P YL G GDYG+D GL Sbjct: 73 EPPSYLTGEFPGDYGWDTAGL 93
>CB22_CUCSA (P08222) Chlorophyll a-b binding protein of LHCII type 1| (Chlorophyll a-b binding protein of LHCII type I) (CAB) (LHCP) (Fragment) Length = 206 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 + P YL G GDYG+D GL Sbjct: 5 EPPSYLTGEFPGDYGWDTAGL 25
>CB29_MAIZE (P27497) Chlorophyll a-b binding protein M9, chloroplast precursor| (LHCII type I CAB-M9) (LHCP) Length = 265 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 + P YL G GDYG+D GL Sbjct: 64 EPPSYLTGEFPGDYGWDTAGL 84
>CB23_SOYBN (P09756) Chlorophyll a-b binding protein 3, chloroplast precursor| (LHCII type I CAB-3) (LHCP) Length = 263 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 + P YL G GDYG+D GL Sbjct: 62 EPPSYLTGEFPGDYGWDTAGL 82
>CB22_MAIZE (P06671) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 265 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 + P YL G GDYG+D GL Sbjct: 64 EPPSYLTGEFPGDYGWDTAGL 84
>CB21_ORYSA (P12330) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 265 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 + P YL G GDYG+D GL Sbjct: 64 EPPSYLTGEFPGDYGWDTAGL 84
>CB21_SOYBN (P12471) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) (Fragment) Length = 245 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 + P YL G GDYG+D GL Sbjct: 44 EPPSYLTGEFPGDYGWDTAGL 64
>CB21_MAIZE (P12329) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 262 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 + P YL G GDYG+D GL Sbjct: 61 EPPSYLTGEFPGDYGWDTAGL 81
>CB21_CUCSA (P08221) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) (Fragment) Length = 255 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 + P YL G GDYG+D GL Sbjct: 54 EPPSYLTGEFPGDYGWDTAGL 74
>CB21_SINAL (P13851) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 266 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 + P YL G GDYG+D GL Sbjct: 64 EPPSYLTGEFPGDYGWDTAGL 84
>PP1RA_PIG (Q767K9) Serine/threonine-protein phosphatase 1 regulatory subunit| 10 (MHC class I region proline-rich protein CAT53) (Protein FB19) Length = 925 Score = 27.3 bits (59), Expect = 10.0 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +3 Query: 18 PNARKGRGGQS*EERVSSHGFVGGRRGEHVPRD-PAGGPGAAERAHRG 158 P+ G G S G GG G H P + P GG G R H G Sbjct: 756 PHEGPGGGMSSGSGHRPHEGPGGGMGGGHRPHEGPGGGMGGGHRPHEG 803
>CO2A1_RAT (P05539) Collagen alpha-1(II) chain precursor [Contains:| Chondrocalcin] Length = 1419 Score = 27.3 bits (59), Expect = 10.0 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +3 Query: 33 GRGGQS*EERVSSHGFVGGRRGEHVPRDPAGGPG-AAERAHRGA 161 G GQ+ E ++ G +GE P P G PG A E RGA Sbjct: 382 GPKGQTGEPGIAGFKGEQGPKGETGPAGPQGAPGPAGEEGKRGA 425
>CO2A1_MOUSE (P28481) Collagen alpha-1(II) chain precursor [Contains:| Chondrocalcin] Length = 1459 Score = 27.3 bits (59), Expect = 10.0 Identities = 20/46 (43%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = +3 Query: 33 GRGGQS*EERVSSHGFVG--GRRGEHVPRDPAGGPG-AAERAHRGA 161 G GQ+ E ++ GF G G +GE P P G PG A E RGA Sbjct: 422 GPKGQAGEPGIA--GFKGDQGPKGETGPAGPQGAPGPAGEEGKRGA 465
>CB23_PETSP (P04781) Chlorophyll a-b binding protein 22R, chloroplast precursor| (LHCII type I CAB-22R) (LHCP) Length = 267 Score = 27.3 bits (59), Expect = 10.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 247 QAPEYLDGTLVGDYGFDPFGL 309 +AP YL G DYG+D GL Sbjct: 66 EAPSYLTGEFPSDYGWDTAGL 86 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,797,411 Number of Sequences: 219361 Number of extensions: 468017 Number of successful extensions: 1585 Number of sequences better than 10.0: 76 Number of HSP's better than 10.0 without gapping: 1343 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1578 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)