ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bast07f01 |
|---|---|
| Clone Library Name | barley_pub |
>TIP11_ORYSA (P50156) Probable aquaporin TIP1.1 (Tonoplast intrinsic protein| 1.1) (OsTIP1.1) (rTIP1) Length = 250 Score = 88.2 bits (217), Expect = 5e-18 Identities = 44/55 (80%), Positives = 47/55 (85%) Frame = +1 Query: 85 MPVSRIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 249 MP+ IAVGSH+EVY GALKAALAEFISTLIFVFAGQGSGMAFSKL+ G TP Sbjct: 1 MPIRNIAVGSHQEVYHPGALKAALAEFISTLIFVFAGQGSGMAFSKLTGGGATTP 55
>TIP12_ARATH (Q41963) Aquaporin TIP1.2 (Tonoplast intrinsic protein 1.2)| (Gamma-tonoplast intrinsic protein 2) (Gamma-TIP2) (Salt stress-induced tonoplast intrinsic protein) Length = 253 Score = 69.3 bits (168), Expect = 2e-12 Identities = 35/56 (62%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +1 Query: 85 MPVSRIAVGS-HREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 249 MP IA+G EVY AL+AALAEFISTLIFVFAG GSG+AF+K++ +G TP Sbjct: 1 MPTRNIAIGGVQEEVYHPNALRAALAEFISTLIFVFAGSGSGIAFNKITDNGATTP 56
>TIP1_MEDTR (Q9FY14) Probable aquaporin TIP-type (MtAQP1)| Length = 250 Score = 69.3 bits (168), Expect = 2e-12 Identities = 34/55 (61%), Positives = 41/55 (74%) Frame = +1 Query: 85 MPVSRIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 249 MP+ IAVG+ +E LKA LAEFIST IFVFAG GSG+A++KL+ DG ATP Sbjct: 1 MPIRNIAVGTPQEATHPDTLKAGLAEFISTFIFVFAGSGSGIAYNKLTNDGAATP 55
>TIP1_MEDSA (P42067) Probable aquaporin TIP-type (Membrane channel protein 1)| (MsMCP1) Length = 249 Score = 69.3 bits (168), Expect = 2e-12 Identities = 34/55 (61%), Positives = 41/55 (74%) Frame = +1 Query: 85 MPVSRIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 249 MP+ IAVG+ +E LKA LAEFIST IFVFAG GSG+A++KL+ DG ATP Sbjct: 1 MPIRNIAVGTPQEATHPDTLKAGLAEFISTFIFVFAGSGSGIAYNKLTNDGAATP 55
>TIP12_ORYSA (Q94CS9) Probable aquaporin TIP1.2 (Tonoplast intrinsic protein| 1.2) (OsTIP1.2) Length = 252 Score = 69.3 bits (168), Expect = 2e-12 Identities = 37/55 (67%), Positives = 41/55 (74%) Frame = +1 Query: 85 MPVSRIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 249 MPVSRIAVG+ E+ KAA+AEFIS LIFVFAG GSGMAFSKL+ G TP Sbjct: 1 MPVSRIAVGAPGELSHPDTAKAAVAEFISMLIFVFAGSGSGMAFSKLTDGGGTTP 55
>TIP13_ARATH (O82598) Putative aquaporin TIP1.3 (Tonoplast intrinsic protein| 1.3) (Gamma-tonoplast intrinsic protein 3) (Gamma-TIP3) Length = 252 Score = 68.9 bits (167), Expect = 3e-12 Identities = 33/55 (60%), Positives = 42/55 (76%) Frame = +1 Query: 85 MPVSRIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 249 MP++RIA+G+ E A++AA AEF S +IFVFAGQGSGMA+ KL+ DG ATP Sbjct: 1 MPINRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATP 55
>TIP11_ARATH (P25818) Aquaporin TIP1.1 (Tonoplast intrinsic protein 1.1)| (Gamma-tonoplast intrinsic protein) (Gamma-TIP) (Aquaporin-TIP) (Tonoplast intrinsic protein, root-specific RB7) Length = 251 Score = 68.6 bits (166), Expect = 4e-12 Identities = 35/55 (63%), Positives = 40/55 (72%) Frame = +1 Query: 85 MPVSRIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 249 MP+ IA+G E ALKAALAEFISTLIFV AG GSGMAF+KL+ +G TP Sbjct: 1 MPIRNIAIGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTP 55
>TIP23_ARATH (Q9FGL2) Probable aquaporin TIP2.3 (Tonoplast intrinsic protein| 2.3) Length = 250 Score = 57.4 bits (137), Expect = 9e-09 Identities = 28/51 (54%), Positives = 38/51 (74%) Frame = +1 Query: 97 RIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 249 +I VGS + + V +LKA L+EFI+TL+FVFAG GS +AF+KL+ DG P Sbjct: 3 KIEVGSVGDSFSVSSLKAYLSEFIATLLFVFAGVGSAVAFAKLTSDGALDP 53
>TIP1_TOBAC (P21653) Probable aquaporin TIP-type RB7-5A (Tonoplast intrinsic| protein, root-specific RB7-5A) (TobRB7) (RT-TIP) Length = 250 Score = 57.4 bits (137), Expect = 9e-09 Identities = 28/51 (54%), Positives = 38/51 (74%) Frame = +1 Query: 97 RIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 249 RIA GS + + VG+LKA +AEFI+TL+FVFAG GS +A++KL+ D P Sbjct: 3 RIAFGSIGDSFSVGSLKAYVAEFIATLLFVFAGVGSAIAYNKLTADAALDP 53
>TIP2_TOBAC (P24422) Probable aquaporin TIP-type RB7-18C (Tonoplast intrinsic| protein, root-specific RB7-18C) (TobRB7) (RT-TIP) Length = 250 Score = 55.5 bits (132), Expect = 3e-08 Identities = 27/50 (54%), Positives = 37/50 (74%) Frame = +1 Query: 100 IAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 249 IA GS + + VG+LKA +AEFI+TL+FVFAG GS +A++KL+ D P Sbjct: 4 IAFGSIGDSFSVGSLKAYVAEFIATLLFVFAGVGSAIAYNKLTADAALDP 53
>TIP22_ARATH (Q41975) Probable aquaporin TIP2.2 (Tonoplast intrinsic protein| 2.2) Length = 250 Score = 55.1 bits (131), Expect = 5e-08 Identities = 26/51 (50%), Positives = 37/51 (72%) Frame = +1 Query: 97 RIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 249 +I +GS + + V +LKA L+EFI+TL+FVFAG GS +AF+KL+ D P Sbjct: 3 KIEIGSVGDSFSVASLKAYLSEFIATLLFVFAGVGSALAFAKLTSDAALDP 53
>TIP_ANTMA (P33560) Probable aquaporin TIP-type (Tonoplast intrinsic protein| DiP) (Dark intrinsic protein) Length = 250 Score = 53.1 bits (126), Expect = 2e-07 Identities = 25/51 (49%), Positives = 37/51 (72%) Frame = +1 Query: 97 RIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 249 +IA GS + + V ++KA +AEFI+TL+FVFAG GS +A++KL+ D P Sbjct: 3 KIAFGSIGDSFSVASIKAYVAEFIATLLFVFAGVGSAIAYNKLTSDAALDP 53
>TIP21_ARATH (Q41951) Aquaporin TIP2.1 (Tonoplast intrinsic protein 2.1)| (Delta-tonoplast intrinsic protein) (Delta-TIP) Length = 250 Score = 51.6 bits (122), Expect = 5e-07 Identities = 24/45 (53%), Positives = 35/45 (77%) Frame = +1 Query: 100 IAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPD 234 +A GS + + + +L+A LAEFISTL+FVFAG GS +A++KL+ D Sbjct: 4 VAFGSFDDSFSLASLRAYLAEFISTLLFVFAGVGSAIAYAKLTSD 48
>TIP43_ORYSA (Q9LWR2) Probable aquaporin TIP4.3 (Tonoplast intrinsic protein| 4.3) (OsTIP4.3) Length = 251 Score = 49.3 bits (116), Expect = 2e-06 Identities = 22/49 (44%), Positives = 34/49 (69%) Frame = +1 Query: 91 VSRIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDG 237 ++++A+G HRE + G L+A +AE + T +FVF+G GS MA +KL G Sbjct: 1 MAKLALGHHREATDPGCLRAVVAELLLTFLFVFSGVGSAMAAAKLGGGG 49
>TIP22_ORYSA (Q5Z6F0) Probable aquaporin TIP2.2 (Tonoplast intrinsic protein| 2.2) (OsTIP2.2) Length = 248 Score = 48.1 bits (113), Expect = 6e-06 Identities = 23/43 (53%), Positives = 32/43 (74%) Frame = +1 Query: 100 IAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLS 228 IA G + + +LKA +AEFISTL+FVFAG GS +A++KL+ Sbjct: 5 IAFGRFDDSFSAASLKAYVAEFISTLVFVFAGVGSAIAYTKLT 47
>TIP21_ORYSA (Q7XA61) Probable aquaporin TIP2.1 (Tonoplast intrinsic protein| 2.1) (OsTIP2.1) Length = 248 Score = 47.0 bits (110), Expect = 1e-05 Identities = 22/51 (43%), Positives = 35/51 (68%) Frame = +1 Query: 97 RIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 249 ++A GS + + ++KA +AEFI+TL+FVFAG GS +A+ +L+ G P Sbjct: 3 KLAFGSLGDSFSATSVKAYVAEFIATLLFVFAGVGSAIAYGQLTNGGALDP 53
>TIPA_PHAVU (P23958) Probable aquaporin TIP-type alpha (Tonoplast intrinsic| protein alpha) (Alpha TIP) Length = 256 Score = 45.8 bits (107), Expect = 3e-05 Identities = 23/50 (46%), Positives = 31/50 (62%) Frame = +1 Query: 85 MPVSRIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPD 234 M R + G E +++A+LAEF ST IFVFAG+GSG+A K+ D Sbjct: 1 MATRRYSFGRTDEATHPDSMRASLAEFASTFIFVFAGEGSGLALVKIYQD 50
>TIP41_ARATH (O82316) Probable aquaporin TIP4.1 (Tonoplast intrinsic protein| 4.1) (Epsilon-tonoplast intrinsic protein) (Epsilon-TIP) Length = 249 Score = 43.1 bits (100), Expect = 2e-04 Identities = 20/45 (44%), Positives = 28/45 (62%) Frame = +1 Query: 91 VSRIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKL 225 + +I +G H E + +KA + EFI+T +FVFAG GS MA L Sbjct: 1 MKKIELGHHSEAAKPDCIKALIVEFITTFLFVFAGVGSAMATDSL 45
>TIP31_ORYSA (Q9FWV6) Probable aquaporin TIP3.1 (Tonoplast intrinsic protein| 3.1) (OsTIP3.1) Length = 264 Score = 42.0 bits (97), Expect = 4e-04 Identities = 22/57 (38%), Positives = 34/57 (59%) Frame = +1 Query: 79 AKMPVSRIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 249 A P R VG + ++AA++EF++T IFVFA +GS ++ KL D ++TP Sbjct: 5 AARPGRRFTVGRSEDATHPDTIRAAISEFLATAIFVFAAEGSILSLGKLYQD-MSTP 60
>TIP32_ARATH (O22588) Probable aquaporin TIP3.2 (Tonoplast intrinsic protein| 3.2) (Beta-tonoplast intrinsic protein) (Beta-TIP) Length = 267 Score = 40.8 bits (94), Expect = 9e-04 Identities = 21/45 (46%), Positives = 28/45 (62%) Frame = +1 Query: 109 GSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVA 243 G E +++A LAEF+ST +FVFAG+GS +A KL D A Sbjct: 12 GRADEATHPDSIRATLAEFLSTFVFVFAGEGSILALDKLYWDTAA 56
>AQP5_HUMAN (P55064) Aquaporin-5 (AQP-5)| Length = 265 Score = 38.5 bits (88), Expect = 0.004 Identities = 19/38 (50%), Positives = 24/38 (63%) Frame = +1 Query: 118 REVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSP 231 +EV V LKA AEF++TLIFVF G GS + + P Sbjct: 3 KEVCSVAFLKAVFAEFLATLIFVFFGLGSALKWPSALP 40
>AQP5_SHEEP (Q866S3) Aquaporin-5 (AQP-5)| Length = 265 Score = 37.4 bits (85), Expect = 0.010 Identities = 18/38 (47%), Positives = 23/38 (60%) Frame = +1 Query: 118 REVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSP 231 +EV LKA AEF++TLIFVF G GS + + P Sbjct: 3 KEVCSAAFLKAVFAEFLATLIFVFFGLGSALKWPSAMP 40
>AQP5_MOUSE (Q9WTY4) Aquaporin-5 (AQP-5)| Length = 265 Score = 37.0 bits (84), Expect = 0.013 Identities = 18/38 (47%), Positives = 23/38 (60%) Frame = +1 Query: 118 REVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSP 231 +EV V KA AEF++TLIFVF G GS + + P Sbjct: 3 KEVCSVAFFKAVFAEFLATLIFVFFGLGSALKWPSALP 40
>TIP41_ORYSA (Q75GA5) Probable aquaporin TIP4.1 (Tonoplast intrinsic protein| 4.1) (OsTIP4.1) Length = 251 Score = 37.0 bits (84), Expect = 0.013 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +1 Query: 115 HREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 249 H EV + G ++A LAE + T +FVF G + MA G A P Sbjct: 10 HGEVVDAGCVRAVLAELVLTFVFVFTGVAATMAAGVPEVAGAAMP 54
>TIP31_ARATH (P26587) Aquaporin TIP3.1 (Tonoplast intrinsic protein 3.1)| (Alpha-tonoplast intrinsic protein) (Alpha-TIP) Length = 268 Score = 36.6 bits (83), Expect = 0.017 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +1 Query: 109 GSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKL 225 G E +++A LAEF+ST +FVFA +GS ++ KL Sbjct: 12 GRADEATHPDSIRATLAEFLSTFVFVFAAEGSILSLDKL 50
>AQP5_RAT (P47864) Aquaporin-5 (AQP-5)| Length = 265 Score = 35.8 bits (81), Expect = 0.028 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = +1 Query: 118 REVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSP 231 +EV + KA AEF++TLIFVF G GS + + P Sbjct: 3 KEVCSLAFFKAVFAEFLATLIFVFFGLGSALKWPSALP 40
>TIP32_ORYSA (Q7XKI5) Probable aquaporin TIP3.2 (Tonoplast intrinsic protein| 3.2) (OsTIP3.2) Length = 265 Score = 35.4 bits (80), Expect = 0.037 Identities = 16/33 (48%), Positives = 23/33 (69%) Frame = +1 Query: 136 GALKAALAEFISTLIFVFAGQGSGMAFSKLSPD 234 GA +AAL+EF++T +FVFA +GS K+ D Sbjct: 26 GATRAALSEFVATAVFVFAAEGSVYGLWKMYRD 58
>AQP2_DASNO (P79164) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 34.3 bits (77), Expect = 0.082 Identities = 15/29 (51%), Positives = 22/29 (75%) Frame = +1 Query: 145 KAALAEFISTLIFVFAGQGSGMAFSKLSP 231 +A LAEF++TLIFVF G GS +++ + P Sbjct: 6 RAVLAEFLATLIFVFFGLGSALSWPQALP 34
>AQP2_RAT (P34080) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 34.3 bits (77), Expect = 0.082 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = +1 Query: 121 EVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSP 231 E+ + +A LAEF++TL+FVF G GS + ++ P Sbjct: 3 ELRSIAFSRAVLAEFLATLLFVFFGLGSALQWASSPP 39
>AQP2_MOUSE (P56402) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 34.3 bits (77), Expect = 0.082 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = +1 Query: 121 EVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSP 231 E+ + +A LAEF++TL+FVF G GS + ++ P Sbjct: 3 ELRSIAFSRAVLAEFLATLLFVFFGLGSALQWASSPP 39
>AQP2_ORYAF (P79200) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 33.5 bits (75), Expect = 0.14 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +1 Query: 145 KAALAEFISTLIFVFAGQGSGMAFSKLSPDGV 240 KA +EF++TL+FVF G GS + + + P G+ Sbjct: 6 KAVFSEFLATLLFVFFGLGSALNWPQALPSGL 37
>TIP51_ORYSA (Q7XU31) Probable aquaporin TIP5.1 (Tonoplast intrinsic protein| 5.1) (OsTIP5.1) Length = 269 Score = 33.5 bits (75), Expect = 0.14 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +1 Query: 139 ALKAALAEFISTLIFVFAGQGSGMAFSKLSPD 234 AL+A AEF ST +FVF GS ++ L+PD Sbjct: 16 ALRAYFAEFFSTFLFVFIAVGSTISARMLTPD 47
>TIP51_ARATH (Q9STX9) Putative aquaporin TIP5.1 (Tonoplast intrinsic protein| 5.1) Length = 256 Score = 33.5 bits (75), Expect = 0.14 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = +1 Query: 124 VYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 249 V + AL+ ++EFIST FV A GS M+ KL V+ P Sbjct: 16 VLSMNALRCYVSEFISTFFFVLAAVGSVMSSRKLMAGDVSGP 57
>AQP2_SHEEP (O62735) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 33.5 bits (75), Expect = 0.14 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = +1 Query: 121 EVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSP 231 E+ + +A LAEF++TL+FVF G GS + + + P Sbjct: 3 ELRSIAFSRAVLAEFLATLLFVFFGLGSALNWPQALP 39
>AQP2_HORSE (P79165) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 32.7 bits (73), Expect = 0.24 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = +1 Query: 145 KAALAEFISTLIFVFAGQGSGMAFSKLSP 231 +A LAEF++TL+FVF G GS + + + P Sbjct: 6 RAVLAEFLATLLFVFFGLGSALNWPQAMP 34
>AQP2_BOVIN (P79099) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 32.3 bits (72), Expect = 0.31 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = +1 Query: 145 KAALAEFISTLIFVFAGQGSGMAFSKLSP 231 +A LAEF++TL+FVF G GS + + + P Sbjct: 6 RAVLAEFLATLLFVFFGLGSALNWPQALP 34
>AQP2_HUMAN (P41181) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 32.0 bits (71), Expect = 0.41 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +1 Query: 121 EVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSP 231 E+ + +A AEF++TL+FVF G GS + + + P Sbjct: 3 ELRSIAFSRAVFAEFLATLLFVFFGLGSALNWPQALP 39
>AQP2_TALEU (O77740) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 31.6 bits (70), Expect = 0.53 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = +1 Query: 145 KAALAEFISTLIFVFAGQGSGMAFSKLSP 231 +A AEF++TLIFVF G GS + + + P Sbjct: 6 RAVFAEFLATLIFVFFGLGSALNWQQSLP 34
>AQP2_PROHA (P79229) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 31.2 bits (69), Expect = 0.70 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +1 Query: 145 KAALAEFISTLIFVFAGQGSGMAFSKLSP 231 +A L+EF++TL+FVF G GS + + + P Sbjct: 6 RAVLSEFLATLLFVFFGLGSALNWPQALP 34
>AQP2_CANFA (P79144) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 30.8 bits (68), Expect = 0.91 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +1 Query: 145 KAALAEFISTLIFVFAGQGSGMAFSKLSP 231 +A AEF++TL+FVF G GS + + + P Sbjct: 6 RAVFAEFLATLLFVFFGLGSALNWPQALP 34
>AQP2_RABIT (P79213) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 30.4 bits (67), Expect = 1.2 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 145 KAALAEFISTLIFVFAGQGSGMAFSKLSP 231 +A AEF++TL+FVF G GS + + P Sbjct: 6 RAVFAEFLATLLFVFFGLGSALNWPSALP 34
>AQP2_ELEMA (P79168) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +1 Query: 145 KAALAEFISTLIFVFAGQGSGMAFSKLSP 231 +A +EF++TL+FVF G GS + + + P Sbjct: 6 RAVFSEFLATLLFVFFGLGSALNWPQALP 34
>AQP2_DUGDU (O77714) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +1 Query: 145 KAALAEFISTLIFVFAGQGSGMAFSKLSP 231 +A +EF++TL+FVF G GS + + + P Sbjct: 6 RAVFSEFLATLLFVFFGLGSALNWPQALP 34
>AQP2_AMBHO (O77697) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +1 Query: 145 KAALAEFISTLIFVFAGQGSGMAFSKLSP 231 +A +EF++TL+FVF G GS + + + P Sbjct: 6 RAVFSEFLATLLFVFFGLGSALNWPQALP 34
>AQP2_ERIEU (O77722) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 29.3 bits (64), Expect = 2.6 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 145 KAALAEFISTLIFVFAGQGSGMAFSKLSP 231 +A EF++TL+FVF G GS + + + P Sbjct: 6 RAVFTEFLATLLFVFFGLGSALNWPQALP 34
>AQP2_MACPR (P79803) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 111 Score = 29.3 bits (64), Expect = 2.6 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 145 KAALAEFISTLIFVFAGQGSGMAFSKLSP 231 +A +EF++TL+FVF G GS + + P Sbjct: 6 RAVFSEFLATLLFVFFGLGSALNWPSTVP 34
>DPO3A_BUCBP (Q89AN8) DNA polymerase III alpha subunit (EC 2.7.7.7)| Length = 1077 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = +1 Query: 97 RIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSK 222 ++ + HRE+++ GA + + +ST IF Q +G AF+K Sbjct: 721 QVEMNKHREMFKNGAKENNINTKLSTKIFNLLEQFAGYAFNK 762
>PIN8_ARATH (Q9FFD0) Putative auxin efflux carrier component 8 (AtPIN8)| Length = 351 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 79 AKMPVSRIAVGSHREVYEVGALKAALAEFISTLIF 183 A M + I +G H +V V ++AAL + I++ IF Sbjct: 280 AAMAIGSIVLGLHGDVLRVAIIQAALPQSITSFIF 314
>AQP1_HUMAN (P29972) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) (Urine water channel) Length = 268 Score = 28.1 bits (61), Expect = 5.9 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 145 KAALAEFISTLIFVFAGQGSGMAF 216 +A +AEF++T +FVF GS + F Sbjct: 11 RAVVAEFLATTLFVFISIGSALGF 34
>AQP4_MOUSE (P55088) Aquaporin-4 (AQP-4) (WCH4) (Mercurial-insensitive water| channel) (MIWC) Length = 323 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +1 Query: 145 KAALAEFISTLIFVFAGQGS 204 KA AEF++TLIFV G GS Sbjct: 36 KAVSAEFLATLIFVLLGVGS 55
>PIN6_ORYSA (Q5JLM1) Probable auxin efflux carrier component 6 (OsPIN6)| Length = 363 Score = 28.1 bits (61), Expect = 5.9 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +1 Query: 79 AKMPVSRIAVGSHREVYEVGALKAALAEFISTLIF 183 A M + IAVG +V V ++AAL + I++ IF Sbjct: 292 AAMAIGSIAVGLRGDVLRVAIIQAALPQSITSFIF 326 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,498,052 Number of Sequences: 219361 Number of extensions: 251415 Number of successful extensions: 1140 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 1135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1140 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
