| Clone Name | bast05c07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NPH3_ORYSA (Q5KS50) Coleoptile phototropism protein 1 (Non-photo... | 30 | 1.5 | 2 | 7UP2_DROME (P16376) Steroid receptor seven-up, isoform A | 30 | 2.0 | 3 | GRLF1_RAT (P81128) Glucocorticoid receptor DNA-binding factor 1 ... | 27 | 10.0 |
|---|
>NPH3_ORYSA (Q5KS50) Coleoptile phototropism protein 1 (Non-phototropic| hypocotyl 3-like protein) (NPH3-like protein) Length = 762 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/17 (88%), Positives = 15/17 (88%), Gaps = 1/17 (5%) Frame = +2 Query: 263 GERGLVPV-LGGGSGRH 310 GERGLVPV GGGSGRH Sbjct: 11 GERGLVPVGGGGGSGRH 27
>7UP2_DROME (P16376) Steroid receptor seven-up, isoform A| Length = 746 Score = 29.6 bits (65), Expect = 2.0 Identities = 20/59 (33%), Positives = 29/59 (49%) Frame = +3 Query: 69 QIHTSPRSRSIISYLLLHLKPSCSSCKTRSIKRENFELASYTHHKQRSPT*RRGGEACG 245 Q+ TS S S+ + L+ + SSC+ +S E LAS Q +P GG+A G Sbjct: 534 QVPTSSASASVSAPLVPSAGSAFSSCQAKSAGSEMDLLASLYAQAQATPPSSGGGDASG 592
>GRLF1_RAT (P81128) Glucocorticoid receptor DNA-binding factor 1 (GAP-associated| protein p190) Length = 1513 Score = 27.3 bits (59), Expect = 10.0 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +3 Query: 72 IHTSPRSRSIISYLLLHLKPSCSSCKTRSIK 164 +H P S + S+LL L P CS C S K Sbjct: 1464 LHLLPVSHHLPSHLLQPLSPQCSHCSPLSSK 1494 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,736,463 Number of Sequences: 219361 Number of extensions: 349119 Number of successful extensions: 859 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 854 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 858 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)