| Clone Name | bast02h06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y1472_HAEIN (P44206) Protein HI1472 precursor | 28 | 7.2 | 2 | GP1BA_HUMAN (P07359) Platelet glycoprotein Ib alpha chain precur... | 28 | 7.2 | 3 | CCNT_DROME (O96433) Cyclin-T | 28 | 9.4 | 4 | AIM1_HUMAN (Q9Y4K1) Absent in melanoma 1 protein | 28 | 9.4 |
|---|
>Y1472_HAEIN (P44206) Protein HI1472 precursor| Length = 351 Score = 28.5 bits (62), Expect = 7.2 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 176 ALLTACLVFPLSFAVLAHSLFTHPILRRIRTSDY 277 +LL ACL+ LSF+ LA + T + R++ D+ Sbjct: 5 SLLIACLLSSLSFSALADRIITDQLDRKVTIPDH 38
>GP1BA_HUMAN (P07359) Platelet glycoprotein Ib alpha chain precursor| (Glycoprotein Ibalpha) (GP-Ib alpha) (GPIbA) (GPIb-alpha) (Antigen CD42b-alpha) (CD42b antigen) [Contains: Glycocalicin] Length = 626 Score = 28.5 bits (62), Expect = 7.2 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +2 Query: 2 PHPTTPRRSSGESKSNRSPDPPSLPTTMELATRDLAALGAGDLV 133 P PTTP +S + S +P+P +PT +AT + A L+ Sbjct: 406 PSPTTPEPTSEPAPSPTTPEPTPIPT---IATSPTILVSATSLI 446
>CCNT_DROME (O96433) Cyclin-T| Length = 1097 Score = 28.1 bits (61), Expect = 9.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 20 RRSSGESKSNRSPDPPSLPTTMELATRDLAALGAG 124 R SS S S++ P PS+P ++R + +G G Sbjct: 440 RSSSSSSSSSQQPGRPSMPVDYHKSSRGMPPVGVG 474
>AIM1_HUMAN (Q9Y4K1) Absent in melanoma 1 protein| Length = 1723 Score = 28.1 bits (61), Expect = 9.4 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 2 PHPTTPRRSSGESKSNRSPDPPSLPTTMELATRDLAALGA 121 P P T + GES ++ P P S PT + +R L A+ A Sbjct: 80 PSPGTKGQLRGESDRSKQPPPASSPTKRKGRSRALEAVPA 119 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,223,948 Number of Sequences: 219361 Number of extensions: 363553 Number of successful extensions: 1611 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1610 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)