| Clone Name | bast01d02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CRIM1_HUMAN (Q9NZV1) Cysteine-rich motor neuron 1 protein precur... | 29 | 4.5 | 2 | UL14_HCMVA (P16756) Hypothetical protein UL14 precursor | 28 | 7.7 |
|---|
>CRIM1_HUMAN (Q9NZV1) Cysteine-rich motor neuron 1 protein precursor (CRIM-1)| (Cysteine-rich repeat-containing protein S52) Length = 1036 Score = 29.3 bits (64), Expect = 4.5 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -3 Query: 384 DLFKYCNIANMK-KCNVLNGCFVSVKFSSSNLCFSRISEI 268 +L CNI N K +CN + C +F S ++C S + I Sbjct: 128 NLIAGCNIINGKCECNTIRTCSNPFEFPSQDMCLSALKRI 167
>UL14_HCMVA (P16756) Hypothetical protein UL14 precursor| Length = 327 Score = 28.5 bits (62), Expect = 7.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 57 GGRWRLEEGGAGRR 16 GGRWR E+GGA +R Sbjct: 110 GGRWRFEDGGAAQR 123 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,096,717 Number of Sequences: 219361 Number of extensions: 697218 Number of successful extensions: 2652 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2648 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)