| Clone Name | bart61f10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATG1_NEUCR (Q7RX99) Serine/threonine-protein kinase atg-1 (EC 2.... | 29 | 5.7 | 2 | NPD_THET2 (Q72IV5) NAD-dependent deacetylase (EC 3.5.1.-) (Regul... | 28 | 7.4 |
|---|
>ATG1_NEUCR (Q7RX99) Serine/threonine-protein kinase atg-1 (EC 2.7.11.1)| (Autophagy-related protein 1) Length = 932 Score = 28.9 bits (63), Expect = 5.7 Identities = 16/61 (26%), Positives = 28/61 (45%), Gaps = 3/61 (4%) Frame = +3 Query: 189 EDLAMSSSPNSNDSGKKNPLDAMGAFFSAQMNRRKLVTTQKLAMSERCT---SCGDEFPG 359 ED + ++NDS N L +G F S ++ +L+ + + MS ++ PG Sbjct: 802 EDHPSHPNNHANDSTALNSLSTVGVFLSEGISAERLMYDRAIEMSRAAAINEIANEDLPG 861 Query: 360 C 362 C Sbjct: 862 C 862
>NPD_THET2 (Q72IV5) NAD-dependent deacetylase (EC 3.5.1.-) (Regulatory protein| SIR2 homolog) Length = 254 Score = 28.5 bits (62), Expect = 7.4 Identities = 16/59 (27%), Positives = 21/59 (35%), Gaps = 12/59 (20%) Frame = +3 Query: 273 AQMNRRKLVTTQKLAMSERCTSCGDEFP------------GCAHRPADRKTWMSELGPD 413 A+ + LV + RC +CG FP C HR W EL P+ Sbjct: 111 ARAGSQNLVELHGNLLRARCEACGKRFPLPEAFAPPPFCPACGHRARPDVVWFGELLPE 169 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,226,249 Number of Sequences: 219361 Number of extensions: 730737 Number of successful extensions: 2222 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2219 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)