| Clone Name | bart61d11 |
|---|---|
| Clone Library Name | barley_pub |
>AOC3_ARATH (Q9LS01) Allene oxide cyclase 3, chloroplast precursor (EC| 5.3.99.6) Length = 258 Score = 75.1 bits (183), Expect = 7e-14 Identities = 35/55 (63%), Positives = 43/55 (78%) Frame = +3 Query: 267 DARPSKVQELHVYELNERDRESPAYLRLSANQSQNALGDLVPFTNKVYNGSLDKR 431 ++RPSK+QEL+VYELNE DR SPA L+L ++ LGDLVPFTNK+Y G L KR Sbjct: 79 NSRPSKIQELNVYELNEGDRNSPAVLKLGKKPTELCLGDLVPFTNKLYTGDLKKR 133
>AOC4_ARATH (Q93ZC5) Allene oxide cyclase 4, chloroplast precursor (EC| 5.3.99.6) Length = 254 Score = 72.8 bits (177), Expect = 3e-13 Identities = 34/54 (62%), Positives = 40/54 (74%) Frame = +3 Query: 270 ARPSKVQELHVYELNERDRESPAYLRLSANQSQNALGDLVPFTNKVYNGSLDKR 431 +RP+K+QEL+VYE NE DR SPA L+L Q LGDLVPFTNK+Y G L KR Sbjct: 76 SRPTKIQELNVYEFNEGDRNSPAVLKLGKKPDQLCLGDLVPFTNKLYTGDLTKR 129
>AOC2_ARATH (Q9LS02) Allene oxide cyclase 2, chloroplast precursor (EC| 5.3.99.6) Length = 253 Score = 64.7 bits (156), Expect = 9e-11 Identities = 34/53 (64%), Positives = 38/53 (71%) Frame = +3 Query: 273 RPSKVQELHVYELNERDRESPAYLRLSANQSQNALGDLVPFTNKVYNGSLDKR 431 RPSKVQEL VYE+NE DR SP L+ +A LGDLVPFTNK+Y G L KR Sbjct: 77 RPSKVQELSVYEINELDRHSPKILK-NAFSLMFGLGDLVPFTNKLYTGDLKKR 128
>AOC1_ARATH (Q9LS03) Allene oxide cyclase 1, chloroplast precursor (EC| 5.3.99.6) (Early-responsive to dehydration 12 protein) Length = 254 Score = 63.9 bits (154), Expect = 2e-10 Identities = 33/53 (62%), Positives = 39/53 (73%) Frame = +3 Query: 273 RPSKVQELHVYELNERDRESPAYLRLSANQSQNALGDLVPFTNKVYNGSLDKR 431 RPSKVQEL VYE+N+ DR SP L+ +A + LGDLVPFTNK+Y G L KR Sbjct: 78 RPSKVQELSVYEINDLDRHSPKILK-NAFSFRFGLGDLVPFTNKLYTGDLKKR 129
>MRD1_NEUCR (Q7SG09) Multiple RNA-binding domain-containing protein 1| Length = 827 Score = 28.5 bits (62), Expect = 7.2 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +3 Query: 237 LFSPKPAVAMDARPSKVQELHVYELNERD 323 LF+ AV DARP+ VQ+ V +L ERD Sbjct: 562 LFTDNVAVPTDARPAGVQKPSVADLLERD 590
>ZN469_HUMAN (Q96JG9) Zinc finger protein 469 (Fragment)| Length = 2469 Score = 28.1 bits (61), Expect = 9.4 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +3 Query: 267 DARPSKVQELHVYELNERDRESPAYLRLSANQSQNALGDLVP 392 D RP + ELH+ R E PA A+ S ++LGD+ P Sbjct: 1497 DDRPEAIPELHMVPAAWRGLEMPA----PADDSSSSLGDVSP 1534 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,746,808 Number of Sequences: 219361 Number of extensions: 343765 Number of successful extensions: 1151 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1149 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)