| Clone Name | bart61c09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NDED_ALCXX (P94211) N-acyl-D-glutamate deacylase (EC 3.5.1.82) (... | 29 | 5.9 | 2 | YKV8_YEAST (P36007) Hypothetical 34.9 kDa protein in COS9-JEN1 i... | 28 | 7.7 |
|---|
>NDED_ALCXX (P94211) N-acyl-D-glutamate deacylase (EC 3.5.1.82)| (N-acyl-D-glutamate amidohydrolase) Length = 488 Score = 28.9 bits (63), Expect = 5.9 Identities = 17/40 (42%), Positives = 19/40 (47%) Frame = +1 Query: 214 IPARTDGFVYGGHAAAPAWGDAVVVEAFFDPVCPDSRDAW 333 +PAR G G A AW D VV +A D VC R W Sbjct: 405 LPARVFGLADRGRLAVGAWADVVVFDA--DTVC--DRATW 440
>YKV8_YEAST (P36007) Hypothetical 34.9 kDa protein in COS9-JEN1 intergenic| region Length = 326 Score = 28.5 bits (62), Expect = 7.7 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 263 GAAACPPYTNPSVLAGIGTCAPQ 195 G A PPY +P V+AG GT A + Sbjct: 141 GFALIPPYDHPDVIAGQGTSAKE 163 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,914,018 Number of Sequences: 219361 Number of extensions: 603016 Number of successful extensions: 1541 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1523 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1541 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)