| Clone Name | bart60f01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NDK3_ARATH (O49203) Nucleoside diphosphate kinase III, chloropla... | 45 | 3e-05 | 2 | NDK4_ARATH (Q8LAH8) Nucleoside diphosphate kinase IV, chloroplas... | 43 | 2e-04 | 3 | NDK4_SPIOL (Q8RXA8) Nucleoside diphosphate kinase 4, chloroplast... | 42 | 5e-04 | 4 | YGFM_ECOLI (P64557) Hypothetical protein ygfM | 28 | 4.2 | 5 | YGFM_ECO57 (P64558) Hypothetical protein ygfM | 28 | 4.2 |
|---|
>NDK3_ARATH (O49203) Nucleoside diphosphate kinase III,| chloroplast/mitochondrial precursor (EC 2.7.4.6) (NDK III) (NDP kinase III) (NDPK III) Length = 238 Score = 45.4 bits (106), Expect = 3e-05 Identities = 23/35 (65%), Positives = 27/35 (77%), Gaps = 3/35 (8%) Frame = +1 Query: 271 AWIA---AIPTAAYMLQGQDVHADEMERTFIAIKP 366 +WI A+P AAYM+Q Q+V A EMERTFIAIKP Sbjct: 63 SWITGLLALPAAAYMIQDQEVLAAEMERTFIAIKP 97
>NDK4_ARATH (Q8LAH8) Nucleoside diphosphate kinase IV,| chloroplast/mitochondrial precursor (EC 2.7.4.6) (NDK IV) (NDP kinase IV) (NDPK IV) (Nucleoside diphosphate kinase 4) Length = 237 Score = 43.1 bits (100), Expect = 2e-04 Identities = 22/35 (62%), Positives = 26/35 (74%), Gaps = 3/35 (8%) Frame = +1 Query: 271 AWIA---AIPTAAYMLQGQDVHADEMERTFIAIKP 366 +WI A+P AA+MLQ Q+ A EMERTFIAIKP Sbjct: 62 SWITGLLALPAAAFMLQDQEALAAEMERTFIAIKP 96
>NDK4_SPIOL (Q8RXA8) Nucleoside diphosphate kinase 4, chloroplast precursor (EC| 2.7.4.6) (Nucleoside diphosphate kinase IV) (NDK IV) (NDP kinase IV) (NDPK IV) (Nucleoside diphosphate kinase III) Length = 235 Score = 41.6 bits (96), Expect = 5e-04 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = +1 Query: 283 AIPTAAYMLQGQDVHADEMERTFIAIKP 366 AIP AAY+LQ Q+ A E ERTFIAIKP Sbjct: 67 AIPAAAYLLQDQEACAAEFERTFIAIKP 94
>YGFM_ECOLI (P64557) Hypothetical protein ygfM| Length = 259 Score = 28.5 bits (62), Expect = 4.2 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -1 Query: 260 EDASLAWWEWEYPAGRVEVLARLPRVASAAFLPS 159 +D L W +W+ A R+ ++RL + A F+P+ Sbjct: 50 QDLELDWVDWDNGALRIGAMSRLQPLRDARFIPA 83
>YGFM_ECO57 (P64558) Hypothetical protein ygfM| Length = 259 Score = 28.5 bits (62), Expect = 4.2 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -1 Query: 260 EDASLAWWEWEYPAGRVEVLARLPRVASAAFLPS 159 +D L W +W+ A R+ ++RL + A F+P+ Sbjct: 50 QDLELDWVDWDNGALRIGAMSRLQPLRDARFIPA 83 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,819,290 Number of Sequences: 219361 Number of extensions: 325671 Number of successful extensions: 1209 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1209 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)