| Clone Name | bart60a10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KSR1_MOUSE (Q61097) Kinase suppressor of ras-1 (Kinase suppresso... | 28 | 8.8 |
|---|
>KSR1_MOUSE (Q61097) Kinase suppressor of ras-1 (Kinase suppressor of ras)| (mKSR1) (Hb protein) Length = 873 Score = 27.7 bits (60), Expect = 8.8 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -3 Query: 167 VWHFGLLWRFRHHRVWHFGHERVR*FRLWQLGH-DGVRR 54 V+ FG +W R W F H+ +WQ+G +GVRR Sbjct: 754 VYAFGTVWYELQARDWPFKHQPAE-ALIWQIGSGEGVRR 791 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,520,264 Number of Sequences: 219361 Number of extensions: 284917 Number of successful extensions: 815 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 797 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 815 length of database: 80,573,946 effective HSP length: 33 effective length of database: 73,335,033 effective search space used: 1760040792 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)