| Clone Name | bart59h01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | S35C2_MOUSE (Q8VCX2) Solute carrier family 35 member C2 (Ovarian... | 34 | 0.21 | 2 | S35C2_HUMAN (Q9NQQ7) Solute carrier family 35 member C2 (Ovarian... | 34 | 0.21 | 3 | FUCT1_CAEEL (Q968A5) GDP-fucose transporter | 32 | 1.1 | 4 | YDB1_SCHPO (Q10354) Hypothetical protein C22E12.01 in chromosome I | 32 | 1.1 | 5 | VMSA_HBVW9 (P17101) Major surface antigen precursor | 29 | 6.8 |
|---|
>S35C2_MOUSE (Q8VCX2) Solute carrier family 35 member C2 (Ovarian cancer| overexpressed gene 1 protein) Length = 364 Score = 33.9 bits (76), Expect = 0.21 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +1 Query: 196 TAGLVAAWYASNIGVLLLNKYLLSFYGFRYPVFLTACHM 312 T GLV +Y +IG+ NK+L F +P+F+T H+ Sbjct: 17 TLGLVLLYYCFSIGITFYNKWLTK--SFHFPLFMTMLHL 53
>S35C2_HUMAN (Q9NQQ7) Solute carrier family 35 member C2 (Ovarian cancer| overexpressed gene 1 protein) Length = 365 Score = 33.9 bits (76), Expect = 0.21 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +1 Query: 196 TAGLVAAWYASNIGVLLLNKYLLSFYGFRYPVFLTACHM 312 T GLV +Y +IG+ NK+L F +P+F+T H+ Sbjct: 17 TLGLVLLYYCFSIGITFYNKWLTK--SFHFPLFMTMLHL 53
>FUCT1_CAEEL (Q968A5) GDP-fucose transporter| Length = 363 Score = 31.6 bits (70), Expect = 1.1 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = +1 Query: 208 VAAWYASNIGVLLLNKYLLSFYGFRYPVFLT 300 V+A++ +IG++ LNKYLLS P+F+T Sbjct: 34 VSAYWVFSIGLVFLNKYLLSSVQLDAPLFIT 64
>YDB1_SCHPO (Q10354) Hypothetical protein C22E12.01 in chromosome I| Length = 374 Score = 31.6 bits (70), Expect = 1.1 Identities = 13/38 (34%), Positives = 26/38 (68%), Gaps = 2/38 (5%) Frame = +1 Query: 205 LVAAWYASNIGVLLLNKYLLSF--YGFRYPVFLTACHM 312 +V AWY ++ + ++NK++ S F++P+FL++C M Sbjct: 56 IVLAWYFFSLLLSMMNKWIFSESKMDFQFPLFLSSCQM 93
>VMSA_HBVW9 (P17101) Major surface antigen precursor| Length = 399 Score = 28.9 bits (63), Expect = 6.8 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 Query: 16 QRAGAGQPDQTKPEPAPAGRQEGRRPT 96 Q G P T P PA A RQ GR+PT Sbjct: 79 QAQGMLTPVSTIPPPASANRQSGRQPT 105 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,638,602 Number of Sequences: 219361 Number of extensions: 356583 Number of successful extensions: 1968 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1865 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1965 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)