| Clone Name | bart58e12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UDU2_ARATH (Q9FHD4) DUF26 domain-containing protein 2 precursor | 36 | 0.031 | 2 | UDU1_ARATH (Q9FHD5) DUF26 domain-containing protein 1 precursor | 31 | 1.3 | 3 | UDU3_ARATH (Q9FHD3) Hypothetical DUF26 domain-containing protein... | 29 | 5.0 | 4 | BMP1_MOUSE (P98063) Bone morphogenetic protein 1 precursor (EC 3... | 29 | 5.0 |
|---|
>UDU2_ARATH (Q9FHD4) DUF26 domain-containing protein 2 precursor| Length = 287 Score = 36.2 bits (82), Expect = 0.031 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 4/85 (4%) Frame = +1 Query: 151 SGVDAIGTYCAK---NGTSAET-QASIDQVLAALVPXXXXXXXXXXXXXXXXXXVWGLAQ 318 S D + T+C K N TS T +++ +L+ L V G+ Sbjct: 24 SDPDDMETFCMKSSRNTTSNTTYNKNLNTLLSTLSNQSSFANYYNLTTGLASDTVHGMFL 83 Query: 319 CRGDVPRQDCSLCLAAAAKEVASSC 393 C GDV R C+ C+ A E+A +C Sbjct: 84 CTGDVNRTTCNACVKNATIEIAKNC 108
>UDU1_ARATH (Q9FHD5) DUF26 domain-containing protein 1 precursor| Length = 286 Score = 30.8 bits (68), Expect = 1.3 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 301 VWGLAQCRGDVPRQDCSLCLAAAAKEVASSC 393 V G+ C GDV R C+ C+ A E+A +C Sbjct: 79 VHGMFLCIGDVNRTTCNACVKNATIEIAKNC 109
>UDU3_ARATH (Q9FHD3) Hypothetical DUF26 domain-containing protein 3 precursor| Length = 287 Score = 28.9 bits (63), Expect = 5.0 Identities = 19/85 (22%), Positives = 34/85 (40%), Gaps = 4/85 (4%) Frame = +1 Query: 151 SGVDAIGTYC---AKNGTSAET-QASIDQVLAALVPXXXXXXXXXXXXXXXXXXVWGLAQ 318 S D + T+C ++N T T +++ +L+ V+G+ Sbjct: 28 SETDHMDTFCIDSSRNTTGNTTYNKNLNTMLSTFRNQSSIVNNYNLTTGLASDTVYGMFL 87 Query: 319 CRGDVPRQDCSLCLAAAAKEVASSC 393 C GDV C+ C+ A E+ +C Sbjct: 88 CTGDVNITTCNNCVKNATIEIVKNC 112
>BMP1_MOUSE (P98063) Bone morphogenetic protein 1 precursor (EC 3.4.24.19)| (BMP-1) (Procollagen C-proteinase) (PCP) (Mammalian tolloid protein) (mTld) Length = 991 Score = 28.9 bits (63), Expect = 5.0 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +3 Query: 318 VPRRRPASGLLALPRRGGQGGRVVLPR 398 +P RRPA+GL L R G+GGR P+ Sbjct: 23 LPARRPAAGLGRLHLRPGRGGRPGAPQ 49 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,825,766 Number of Sequences: 219361 Number of extensions: 284132 Number of successful extensions: 861 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 851 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 861 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)