| Clone Name | bart58c04 |
|---|---|
| Clone Library Name | barley_pub |
>CY12_SOLTU (P29610) Cytochrome c1, heme protein, mitochondrial precursor| (Clone PC18I) (Fragment) Length = 260 Score = 66.6 bits (161), Expect = 2e-11 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +2 Query: 311 FGTIASADEAEHGLAAAEYPWPHAGILSSYDHASXR 418 F T+ASADEAEHGL YPWPHAGILSSYDHAS R Sbjct: 11 FATVASADEAEHGLECPSYPWPHAGILSSYDHASIR 46
>CY11_SOLTU (P25076) Cytochrome c1, heme protein, mitochondrial precursor| (Clone PC13III) Length = 320 Score = 61.6 bits (148), Expect = 7e-10 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = +2 Query: 311 FGTIASADEAEHGLAAAEYPWPHAGILSSYDHASXR 418 F TIA +DEAEHGL YPWPH GILSSYDHAS R Sbjct: 71 FATIAYSDEAEHGLECPNYPWPHEGILSSYDHASIR 106
>CY1_YEAST (P07143) Cytochrome c1, heme protein, mitochondrial precursor| Length = 309 Score = 36.6 bits (83), Expect = 0.024 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +2 Query: 317 TIASADEAEHGLAAAEYPWPHAGILSSYDHASXR 418 T + AEHGL A Y W H G ++DHAS R Sbjct: 58 TAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIR 91
>CY1_KLULA (Q00988) Cytochrome c1, heme protein, mitochondrial precursor| Length = 292 Score = 35.8 bits (81), Expect = 0.041 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = +2 Query: 338 AEHGLAAAEYPWPHAGILSSYDHASXR 418 AEHGL A Y W H G L ++DH+S R Sbjct: 50 AEHGLHAPGYGWSHNGPLETFDHSSIR 76
>CY1_NEUCR (P07142) Cytochrome c1, heme protein, mitochondrial precursor| Length = 332 Score = 34.7 bits (78), Expect = 0.092 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 311 FGTIASADEAEHGLAAAEYPWPHAGILSSYDHASXR 418 +G ++ AE GL A +YPW H L ++DH + R Sbjct: 65 YGFASAMTPAEEGLHATKYPWVHEQWLKTFDHQALR 100
>CY1_MOUSE (Q9D0M3) Cytochrome c1, heme protein, mitochondrial precursor| (Cytochrome c-1) Length = 325 Score = 32.7 bits (73), Expect = 0.35 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = +2 Query: 326 SADEAEHGLAAAEYPWPHAGILSSYDHASXR 418 SA + E L YPW H G+LSS DH S R Sbjct: 83 SASDLE--LHPPSYPWSHRGLLSSLDHTSIR 111
>CY1_HUMAN (P08574) Cytochrome c1, heme protein, mitochondrial precursor| (Cytochrome c-1) Length = 325 Score = 32.7 bits (73), Expect = 0.35 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = +2 Query: 326 SADEAEHGLAAAEYPWPHAGILSSYDHASXR 418 SA + E L YPW H G+LSS DH S R Sbjct: 83 SASDLE--LHPPSYPWSHRGLLSSLDHTSIR 111
>CY1_BOVIN (P00125) Cytochrome c1, heme protein, mitochondrial (Cytochrome| c-1) Length = 241 Score = 32.3 bits (72), Expect = 0.45 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +2 Query: 365 YPWPHAGILSSYDHASXR 418 YPW H G+LSS DH S R Sbjct: 10 YPWSHRGLLSSLDHTSIR 27
>SFRIP_HUMAN (Q99590) SFRS2-interacting protein (Splicing factor,| arginine/serine-rich 2-interacting protein) (SC35-interacting protein 1) (CTD-associated SR protein 11) (Splicing regulatory protein 129) (SRrp129) (NY-REN-40 antigen) Length = 1148 Score = 30.0 bits (66), Expect = 2.3 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -2 Query: 306 KRPEAPTPRRANALSPAEDSSCFPRNEESR 217 KRP++P+PRR + S P+NE +R Sbjct: 497 KRPQSPSPRRETGKESRKSQSPSPKNESAR 526
>SRP_DROME (P52172) Box A-binding factor (ABF) (GATA-binding factor-B)| (Transcription factor GATA-B) (dGATA-B) (Protein serpent) Length = 1264 Score = 29.6 bits (65), Expect = 2.9 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -3 Query: 362 LQLPNHARLHLQMLSYQNIKDQKHQLREEPMLSVQQRTLH 243 +Q PN + HLQ +Q + Q+HQ ++ L QQ+ H Sbjct: 519 MQSPNQTQAHLQQQHHQQ-QQQQHQQHQQQQLQQQQQQHH 557
>DOC2B_MOUSE (P70169) Double C2-like domain-containing protein beta (Doc2-beta)| Length = 412 Score = 28.9 bits (63), Expect = 5.0 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -2 Query: 318 VPKHKRPEAPTPRRANALSPAEDSSCFPRNEESRDEPED 202 +P P AP P A A SPA +S ++ +RD+ ED Sbjct: 44 LPPTAAPRAPAPPDAPARSPAASASPRSPSDGARDDDED 82
>QCRB_MYCLE (P15878) Ubiquinol-cytochrome c reductase cytochrome b subunit| Length = 551 Score = 28.5 bits (62), Expect = 6.6 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 253 LCWTESIGSSRSWCFWSFMFWYDSI 327 + WTE G +R W W F FW+ +I Sbjct: 309 MMWTE--GLARIWPAWEFYFWHHTI 331
>UPC2_YEAST (Q12151) Sterol uptake control protein 2 (Mannoprotein regulation| by oxygen protein 4) Length = 913 Score = 28.1 bits (61), Expect = 8.6 Identities = 15/61 (24%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = -3 Query: 383 QHAARGTLQLPNHARLHLQMLSYQNIKDQKH-QLREEPMLSVQQRTLHAFPEMKKAEMSQ 207 Q+ LQL H ++ LQ YQ ++ ++H Q++++ +QQ H + ++ + Q Sbjct: 293 QYQLHQQLQLQQHQQVQLQQ--YQQLRQEQHQQVQQQQQEQLQQYQQHFLQQQQQVLLQQ 350 Query: 206 K 204 + Sbjct: 351 E 351 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,409,995 Number of Sequences: 219361 Number of extensions: 753066 Number of successful extensions: 2369 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2300 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2368 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)