| Clone Name | bart57h09 |
|---|---|
| Clone Library Name | barley_pub |
>PCSK5_BRACL (Q9NJ15) Proprotein convertase subtilisin/kexin type 5 precursor| (EC 3.4.21.-) (Proprotein convertase PC6-like) (aPC6) Length = 1696 Score = 34.7 bits (78), Expect = 0.19 Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +1 Query: 349 KCE-CNMYCLDCINGALCSQCLACHH 423 KCE CN+ C C NG+ QCL CHH Sbjct: 873 KCEDCNIICKKC-NGSQADQCLECHH 897
>ITB7_MOUSE (P26011) Integrin beta-7 precursor (Integrin beta-P) (M290 IEL| antigen) Length = 806 Score = 33.9 bits (76), Expect = 0.33 Identities = 17/34 (50%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +1 Query: 319 GQCKMHADAHKCECNM-YCLDCINGALCSQCLAC 417 G C H C+CN CLD GALC QCL C Sbjct: 611 GLCSGHG---YCKCNRCQCLDGYYGALCDQCLGC 641
>FUR1C_DROME (P30430) Furin-like protease 1, isoform 1-CRR precursor (EC| 3.4.21.75) (Furin-1) (Kex2-like endoprotease 1) (dKLIP-1) Length = 1101 Score = 32.7 bits (73), Expect = 0.73 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +1 Query: 358 CNMYCLDCINGALCSQCLACHHGHHAIQIRRSS--YHDVIRVSEIQKVLDIT 507 C+ CL+C GAL SQC C G +I + Y V+R + + V+DI+ Sbjct: 949 CDRSCLECY-GALASQCSTCSPGSQLRKILNETFCYAYVVRSTGMASVVDIS 999
>ITB7_HUMAN (P26010) Integrin beta-7 precursor| Length = 798 Score = 32.7 bits (73), Expect = 0.73 Identities = 16/34 (47%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +1 Query: 319 GQCKMHADAHKCECNM-YCLDCINGALCSQCLAC 417 G C H +C+CN CLD GALC QC C Sbjct: 611 GLCSGHG---RCKCNRCQCLDGYYGALCDQCPGC 641
>LAMB2_RAT (P15800) Laminin beta-2 chain precursor (S-laminin) (Laminin chain| B3) Length = 1801 Score = 32.3 bits (72), Expect = 0.95 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Frame = +1 Query: 244 GGECDEAENQRWP-PWLKPLLATSFFGQCKMHADAHKCECNMYCLDCINGALCSQCLACH 420 G CD + +W P +P + +C DAH C + C D G C +C+A Sbjct: 861 GLRCDHCQRGQWGFPNCRPCVCNGRADEC----DAHTGAC-LGCRDYTGGEHCERCIAGF 915 Query: 421 HG 426 HG Sbjct: 916 HG 917
>VPX_HV2SB (P12454) VPX protein (X ORF protein) (Viral accessory protein)| Length = 112 Score = 32.3 bits (72), Expect = 0.95 Identities = 23/71 (32%), Positives = 29/71 (40%), Gaps = 2/71 (2%) Frame = -1 Query: 446 RIWMAWWPWWQARHWEQRAPLMQSRQYMLHSHLCA--SACILHCPKKLVASSGLSHGGQR 273 ++W W +W H EQ SR Y + +LC A +H KK G HG Sbjct: 47 QVWQRSWRYW---HDEQG----MSRSYTKYRYLCLMQKAVFMHF-KKGCTCRGEGHGPGG 98 Query: 272 WFSASSHSPPP 240 W S PPP Sbjct: 99 WRSGPPPPPPP 109
>SREC2_HUMAN (Q96GP6) Scavenger receptor class F member 2 precursor (Scavenger| receptor expressed by endothelial cells 2 protein) (SREC-II) (SRECRP-1) Length = 866 Score = 31.6 bits (70), Expect = 1.6 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 319 GQCKMHADAHKCECNMYCLDCINGALCSQCLACH 420 G+C H CN+ C ++GA C+Q +CH Sbjct: 389 GRCLCSPGVHGPHCNVTCPPGLHGADCAQACSCH 422
>RDS_MOUSE (P15499) Peripherin (Retinal degeneration slow protein)| Length = 346 Score = 31.2 bits (69), Expect = 2.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 229 AGRMGGGECDEAENQRWPPWLKPLLATSFF 318 AG++ D A+ +W PWLKP LA F Sbjct: 78 AGKICYDALDPAKYAKWKPWLKPYLAVCIF 107
>LAMB1_DROME (P11046) Laminin beta-1 chain precursor (Laminin B1 chain)| Length = 1790 Score = 30.8 bits (68), Expect = 2.8 Identities = 25/94 (26%), Positives = 34/94 (36%), Gaps = 12/94 (12%) Frame = +1 Query: 220 TNRAGRMGGGECDEAENQRWPPWLKPLLATSFFGQCKMHADAHKCECNMYCLDC------ 381 T+ M EC++ N PW KP CK KCECN + + C Sbjct: 323 THNTKGMNCEECEDFFNDL--PW-KPAFGKKT-NACK------KCECNDHAVSCHFDEAV 372 Query: 382 ------INGALCSQCLACHHGHHAIQIRRSSYHD 465 ++G +C CL G H + Y D Sbjct: 373 FTASGFVSGGVCDNCLHNTRGQHCEECMPYFYRD 406
>RS4_METAC (Q8TRR1) 30S ribosomal protein S4P| Length = 218 Score = 30.8 bits (68), Expect = 2.8 Identities = 17/65 (26%), Positives = 29/65 (44%) Frame = -1 Query: 386 LMQSRQYMLHSHLCASACILHCPKKLVASSGLSHGGQRWFSASSHSPPPMRPALLVLILS 207 ++Q+RQ++ H H+ + P LV+ H G S + P RP + L+ Sbjct: 126 VIQARQFITHGHIAINGRKATIPGMLVSKEDEMHIGYYGNSPLKNESHPERPVQVASFLA 185 Query: 206 SSGAS 192 SG + Sbjct: 186 DSGTT 190
>LAMB2_MOUSE (Q61292) Laminin beta-2 chain precursor (S-laminin) (S-LAM)| Length = 1799 Score = 30.8 bits (68), Expect = 2.8 Identities = 18/62 (29%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Frame = +1 Query: 244 GGECDEAENQRWP-PWLKPLLATSFFGQCKMHADAHKCECNMYCLDCINGALCSQCLACH 420 G CD + +W P +P + +C H A C + C D G C +C+A Sbjct: 859 GLRCDHCQRGQWGFPNCRPCVCNGRADECDTHTGA----C-LGCRDYTGGEHCERCIAGF 913 Query: 421 HG 426 HG Sbjct: 914 HG 915
>RHG06_MOUSE (O54834) Rho-GTPase-activating protein 6 (Rho-type| GTPase-activating protein RhoGAPX-1) Length = 986 Score = 30.4 bits (67), Expect = 3.6 Identities = 23/80 (28%), Positives = 35/80 (43%), Gaps = 6/80 (7%) Frame = -1 Query: 395 RAPLMQSRQYMLHSHLCAS-ACILHCPKKLVASSGLSHGG-----QRWFSASSHSPPPMR 234 R+ L +S + L S L S + P +V+SSG G +RW PPP Sbjct: 126 RSGLKKSMAWDLPSVLAGSGSASSRSPASIVSSSGGGPNGIFSSPRRWLQQRKFQPPPNS 185 Query: 233 PALLVLILSSSGASWWNAIS 174 + ++ S G WN++S Sbjct: 186 RSHPYVVWRSEGDFTWNSMS 205
>ZSWM2_MOUSE (Q9D9X6) Zinc finger SWIM domain-containing protein 2| Length = 631 Score = 30.4 bits (67), Expect = 3.6 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 4/48 (8%) Frame = +1 Query: 370 CLDCINGALCSQCL-ACHHGHHAI---QIRRSSYHDVIRVSEIQKVLD 501 C +C+ LC +C +C H HA + R + V + SE+ K L+ Sbjct: 250 CTECVEYHLCQECFDSCCHSSHAFASREKRNQRWRSVEKRSEVMKYLN 297
>RDS_HUMAN (P23942) Peripherin (Retinal degeneration slow protein)| (Tetraspanin-22) (Tspan-22) Length = 346 Score = 30.4 bits (67), Expect = 3.6 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 229 AGRMGGGECDEAENQRWPPWLKPLLA 306 AG++ D A+ RW PWLKP LA Sbjct: 78 AGKICYDALDPAKYARWKPWLKPYLA 103
>DL_DROME (P10041) Neurogenic locus protein delta precursor| Length = 833 Score = 30.0 bits (66), Expect = 4.7 Identities = 21/69 (30%), Positives = 30/69 (43%), Gaps = 4/69 (5%) Frame = +1 Query: 238 MGGGECDEAENQRWPPWLKPLLATSFFG-QCKMHAD---AHKCECNMYCLDCINGALCSQ 405 + GG C P K + F G +C+ + D H+CE C+D +N C Q Sbjct: 428 INGGSCQ--------PSGKCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRC-Q 478 Query: 406 CLACHHGHH 432 C+ HG H Sbjct: 479 CVPGFHGTH 487
>LTBP4_MOUSE (Q8K4G1) Latent transforming growth factor beta-binding protein 4| precursor (LTBP-4) Length = 1666 Score = 30.0 bits (66), Expect = 4.7 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 5/67 (7%) Frame = +1 Query: 247 GECDEAENQR---WPPWLKPLLATSFFGQCKMHADAHKCECNMYC--LDCINGALCSQCL 411 G C+ E P +P A S +C+ D +CE + C +C+N QC Sbjct: 809 GRCENTEGSFKCVCPTGFQPNAAGS---ECE---DVDECENRLACPGQECVNSPGSFQCR 862 Query: 412 ACHHGHH 432 AC GHH Sbjct: 863 ACPVGHH 869
>NEUL_RAT (P42676) Neurolysin, mitochondrial precursor (EC 3.4.24.16)| (Neurotensin endopeptidase) (Mitochondrial oligopeptidase M) (Microsomal endopeptidase) (MEP) Length = 704 Score = 30.0 bits (66), Expect = 4.7 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 130 PLLALCCVPRLVRRTEMAFH 189 P++ CCVP R+ EMAFH Sbjct: 250 PVMKKCCVPETRRKMEMAFH 269
>SREC2_MOUSE (P59222) Scavenger receptor class F member 2 precursor (Scavenger| receptor expressed by endothelial cells 2 protein) (SREC-II) Length = 833 Score = 29.6 bits (65), Expect = 6.1 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 319 GQCKMHADAHKCECNMYCLDCINGALCSQCLACH 420 G+C H CN+ C ++G C+Q +CH Sbjct: 381 GRCLCSPGVHGPHCNVTCPAGLHGVDCAQACSCH 414
>PCSK5_RAT (P41413) Proprotein convertase subtilisin/kexin type 5 precursor| (EC 3.4.21.-) (Proprotein convertase PC5) (Subtilisin/kexin-like protease PC5) (rPC5) (PC6) (Fragment) Length = 1877 Score = 29.3 bits (64), Expect = 8.0 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 9/54 (16%) Frame = +1 Query: 334 HADAHKC-ECNMYCLDCINGALCSQCLACHHGHH--------AIQIRRSSYHDV 468 HAD +C +C C C G+ QCL+C +G+ Q SY D+ Sbjct: 682 HADKKRCRKCAPNCESCF-GSHADQCLSCKYGYFLNEETSSCVAQCPEGSYQDI 734
>RDS_BOVIN (P17810) Peripherin (Retinal degeneration slow protein)| Length = 345 Score = 29.3 bits (64), Expect = 8.0 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 229 AGRMGGGECDEAENQRWPPWLKPLLA 306 AG++ D A+ +W PWLKP LA Sbjct: 77 AGKICYDALDPAKYAKWKPWLKPYLA 102
>RCEL_RHOSH (P0C0Y8) Reaction center protein L chain (Photosynthetic reaction| center L subunit) Length = 281 Score = 29.3 bits (64), Expect = 8.0 Identities = 9/27 (33%), Positives = 12/27 (44%) Frame = -1 Query: 467 TSWYEDLRIWMAWWPWWQARHWEQRAP 387 T W++ W+ WW WW W P Sbjct: 253 TIWFDQ---WVDWWQWWVKLPWWANIP 276
>RCEL_RHOS4 (Q3J1A5) Reaction center protein L chain (Photosynthetic reaction| center L subunit) Length = 281 Score = 29.3 bits (64), Expect = 8.0 Identities = 9/27 (33%), Positives = 12/27 (44%) Frame = -1 Query: 467 TSWYEDLRIWMAWWPWWQARHWEQRAP 387 T W++ W+ WW WW W P Sbjct: 253 TIWFDQ---WVDWWQWWVKLPWWANIP 276
>RDS_CANFA (P52204) Peripherin (Retinal degeneration slow protein)| Length = 346 Score = 29.3 bits (64), Expect = 8.0 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 229 AGRMGGGECDEAENQRWPPWLKPLLA 306 AG++ D A+ +W PWLKP LA Sbjct: 78 AGKICYDALDPAKYAKWKPWLKPYLA 103 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,316,681 Number of Sequences: 219361 Number of extensions: 961547 Number of successful extensions: 4284 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 4066 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4278 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4643056080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)