| Clone Name | bart57g02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CTN2_MOUSE (Q61301) Alpha-2 catenin (Alpha-catenin-related prote... | 30 | 5.3 | 2 | CTN2_HUMAN (P26232) Alpha-2 catenin (Alpha-catenin-related prote... | 29 | 6.9 | 3 | CTN2_CHICK (P30997) Alpha-2 catenin (Alpha N-catenin) (Neural al... | 29 | 9.0 |
|---|
>CTN2_MOUSE (Q61301) Alpha-2 catenin (Alpha-catenin-related protein) (Alpha| N-catenin) Length = 952 Score = 29.6 bits (65), Expect = 5.3 Identities = 18/48 (37%), Positives = 22/48 (45%) Frame = -2 Query: 503 ATRARVTIRSYSSEPRDQLAMGVPPCAQGTSPTTAPRGHAGDRSSACA 360 ATRA R Y + + G+ AQ TSPT +GH G A A Sbjct: 234 ATRAN---RDYVFKQVQEAIAGISSAAQATSPTDEAKGHTGIGELAAA 278
>CTN2_HUMAN (P26232) Alpha-2 catenin (Alpha-catenin-related protein) (Alpha| N-catenin) Length = 952 Score = 29.3 bits (64), Expect = 6.9 Identities = 18/48 (37%), Positives = 22/48 (45%) Frame = -2 Query: 503 ATRARVTIRSYSSEPRDQLAMGVPPCAQGTSPTTAPRGHAGDRSSACA 360 ATRA R Y + + G+ AQ TSPT +GH G A A Sbjct: 234 ATRAN---RDYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAA 278
>CTN2_CHICK (P30997) Alpha-2 catenin (Alpha N-catenin) (Neural alpha-catenin)| Length = 906 Score = 28.9 bits (63), Expect = 9.0 Identities = 18/48 (37%), Positives = 22/48 (45%) Frame = -2 Query: 503 ATRARVTIRSYSSEPRDQLAMGVPPCAQGTSPTTAPRGHAGDRSSACA 360 ATRA R Y + + G+ AQ TSPT +GH G A A Sbjct: 235 ATRAN---RDYVFKQVQEAIAGISNAAQATSPTDENKGHTGIGELAAA 279 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,130,574 Number of Sequences: 219361 Number of extensions: 705554 Number of successful extensions: 3329 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3097 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3325 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3985467738 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)