| Clone Name | bart56g03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GLGB_NOCFA (Q5Z0W8) 1,4-alpha-glucan branching enzyme (EC 2.4.1.... | 31 | 3.0 | 2 | NODO_RHILV (P15728) Nodulation protein O | 30 | 4.0 | 3 | TYSY_STRT2 (Q5M5B3) Thymidylate synthase (EC 2.1.1.45) (TS) (TSase) | 30 | 6.7 | 4 | TYSY_STRT1 (Q5M0S7) Thymidylate synthase (EC 2.1.1.45) (TS) (TSase) | 30 | 6.7 |
|---|
>GLGB_NOCFA (Q5Z0W8) 1,4-alpha-glucan branching enzyme (EC 2.4.1.18) (Glycogen| branching enzyme) (BE) (1,4-alpha-D-glucan:1,4-alpha-D-glucan 6-glucosyl-transferase) Length = 744 Score = 30.8 bits (68), Expect = 3.0 Identities = 24/68 (35%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Frame = +3 Query: 342 GSLPMSIPDWQKILGGEYRDHY--AGEWE--LDGDDDDYSKLGAGCRSGSVVPPHELAWR 509 GS + ++ L GEYR AGEW L+ D DY G+G + VV E+ W Sbjct: 664 GSTVACVFNFSGALHGEYRVGLPIAGEWTEILNTDAADYG--GSGVGNYGVVRTEEIPWH 721 Query: 510 SRAASLSV 533 R S +V Sbjct: 722 GRPVSATV 729
>NODO_RHILV (P15728) Nodulation protein O| Length = 284 Score = 30.4 bits (67), Expect = 4.0 Identities = 24/82 (29%), Positives = 35/82 (42%) Frame = +3 Query: 330 GAVPGSLPMSIPDWQKILGGEYRDHYAGEWELDGDDDDYSKLGAGCRSGSVVPPHELAWR 509 G+ GS P+ I GG+ D W G+ DD K G G S + P H++ W Sbjct: 5 GSDNGSFIKGSPENDIIDGGKKND-----WIDAGNGDDRIKAGDGQDSITAGPGHDIVWA 59 Query: 510 SRAASLSVHEGVGRTLKGRDLS 575 + + + +H G L D S Sbjct: 60 GKGSDV-IHADGGDDLLYSDAS 80
>TYSY_STRT2 (Q5M5B3) Thymidylate synthase (EC 2.1.1.45) (TS) (TSase)| Length = 286 Score = 29.6 bits (65), Expect = 6.7 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +3 Query: 378 ILGGEYRDHYAGEWELDG-DDDDYSKLGAGCRSGSVVPPHEL 500 +L +Y HY +WE++G ++ K G R G+VV H++ Sbjct: 84 VLEDKYNVHYWNDWEVEGVPANNGDKRSIGQRYGAVVKKHDI 125
>TYSY_STRT1 (Q5M0S7) Thymidylate synthase (EC 2.1.1.45) (TS) (TSase)| Length = 286 Score = 29.6 bits (65), Expect = 6.7 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +3 Query: 378 ILGGEYRDHYAGEWELDG-DDDDYSKLGAGCRSGSVVPPHEL 500 +L +Y HY +WE++G ++ K G R G+VV H++ Sbjct: 84 VLEDKYNVHYWNDWEVEGVPANNGDKRSIGQRYGAVVKKHDI 125 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,155,099 Number of Sequences: 219361 Number of extensions: 1031350 Number of successful extensions: 3411 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3159 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3407 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5101629520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)