| Clone Name | bart56a10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UNG_BORPE (Q7VUM8) Uracil-DNA glycosylase (EC 3.2.2.-) (UDG) | 30 | 3.7 | 2 | UNG_BORPA (Q7W1Y7) Uracil-DNA glycosylase (EC 3.2.2.-) (UDG) | 30 | 3.7 | 3 | UNG_BORBR (Q7WQW5) Uracil-DNA glycosylase (EC 3.2.2.-) (UDG) | 30 | 3.7 | 4 | S13A3_MOUSE (Q91Y63) Solute carrier family 13 member 3 (Sodium-d... | 29 | 8.2 |
|---|
>UNG_BORPE (Q7VUM8) Uracil-DNA glycosylase (EC 3.2.2.-) (UDG)| Length = 250 Score = 30.4 bits (67), Expect = 3.7 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = -1 Query: 525 LVPLRHHHLILSKHHPFPRSWLGTPS*FCDLCWHGRRSAKWVLRR 391 LVP HL+L+ +HP P S P F C H R++ W+ +R Sbjct: 185 LVPADAGHLVLAANHPSPLSARRPPVPFVG-CGHFRQTNAWLQQR 228
>UNG_BORPA (Q7W1Y7) Uracil-DNA glycosylase (EC 3.2.2.-) (UDG)| Length = 250 Score = 30.4 bits (67), Expect = 3.7 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = -1 Query: 525 LVPLRHHHLILSKHHPFPRSWLGTPS*FCDLCWHGRRSAKWVLRR 391 LVP HL+L+ +HP P S P F C H R++ W+ +R Sbjct: 185 LVPADAGHLVLAANHPSPLSARRPPVPFVG-CGHFRQTNAWLQQR 228
>UNG_BORBR (Q7WQW5) Uracil-DNA glycosylase (EC 3.2.2.-) (UDG)| Length = 250 Score = 30.4 bits (67), Expect = 3.7 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = -1 Query: 525 LVPLRHHHLILSKHHPFPRSWLGTPS*FCDLCWHGRRSAKWVLRR 391 LVP HL+L+ +HP P S P F C H R++ W+ +R Sbjct: 185 LVPADAGHLVLAANHPSPLSARRPPVPFVG-CGHFRQTNAWLQQR 228
>S13A3_MOUSE (Q91Y63) Solute carrier family 13 member 3 (Sodium-dependent| high-affinity dicarboxylate transporter 2) (Na(+)/dicarboxylate cotransporter 3) (NaDC-3) (mNaDC3) Length = 600 Score = 29.3 bits (64), Expect = 8.2 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = +3 Query: 282 IAQDGDESSVPGGVEGAIWQPRQQQLVAKSKAAHDPVVEAPTSPNVVRANRDHK--IKKG 455 + ++GDES+ G P + Q +A S+ H EAP +H+ I KG Sbjct: 172 LPREGDESTAAVQGNGLRTVPTEMQFLASSEGGHTEDAEAPMELPDDSKEEEHRRNIWKG 231 Query: 456 FL 461 FL Sbjct: 232 FL 233 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,262,042 Number of Sequences: 219361 Number of extensions: 1412357 Number of successful extensions: 4064 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4062 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4757699440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)