| Clone Name | bart56a07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BSN_HUMAN (Q9UPA5) Bassoon protein (Zinc-finger protein 231) | 32 | 1.4 | 2 | SF01_MOUSE (Q64213) Splicing factor 1 (Zinc finger protein 162) ... | 31 | 2.4 | 3 | SLOU_DROME (P22807) Homeobox protein slou (S59/2) (Protein slouc... | 31 | 2.4 |
|---|
>BSN_HUMAN (Q9UPA5) Bassoon protein (Zinc-finger protein 231)| Length = 3925 Score = 32.0 bits (71), Expect = 1.4 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 211 PRPHGSPLPPVATTSDTLCSSSSM 140 PRP G PLPP T CSS SM Sbjct: 3513 PRPAGGPLPPGGDTCPQFCSSHSM 3536
>SF01_MOUSE (Q64213) Splicing factor 1 (Zinc finger protein 162) (Transcription| factor ZFM1) (mZFM) (Zinc finger gene in MEN1 locus) (Mammalian branch point-binding protein mBBP) (BBP) (CW17) Length = 653 Score = 31.2 bits (69), Expect = 2.4 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = -2 Query: 211 PRPHGSPLPPVATTSDTLC---SSSSM*MEPNPAKK-PITDDSAPVMEARDHSRP 59 P P G+P PP + LC S +S+ + PN A + P P E+ D RP Sbjct: 576 PLPPGAPPPPTCSIECLLCLLSSPNSLCLSPNRAARIPPRGSDGPSHESEDFPRP 630
>SLOU_DROME (P22807) Homeobox protein slou (S59/2) (Protein slouch) (Homeobox| protein NK-1) Length = 659 Score = 31.2 bits (69), Expect = 2.4 Identities = 15/51 (29%), Positives = 22/51 (43%) Frame = -2 Query: 211 PRPHGSPLPPVATTSDTLCSSSSM*MEPNPAKKPITDDSAPVMEARDHSRP 59 P PH P P + SSS P+PA P++ ++P M + P Sbjct: 224 PHPHPHPHPHPSAVFHLRAPSSSSTAPPSPATSPLSPPTSPAMHSDQQMSP 274 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,255,217 Number of Sequences: 219361 Number of extensions: 900807 Number of successful extensions: 2871 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2766 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2867 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5216272880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)