| Clone Name | bart56a03 |
|---|---|
| Clone Library Name | barley_pub |
>PSNA_ARATH (O64668) Presenilin-like protein At1g08700| Length = 453 Score = 53.5 bits (127), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +2 Query: 437 AFWFTLLPEWTTWALLVDMAVYDLGAVLIPGG 532 A WFT LPEWTTW +LV +A+YDL AVL PGG Sbjct: 168 AAWFTKLPEWTTWFILVALALYDLVAVLAPGG 199
>PSNB_ARATH (Q9SIK7) Presenilin-like protein At2g29900| Length = 397 Score = 53.5 bits (127), Expect = 3e-07 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = +2 Query: 437 AFWFTLLPEWTTWALLVDMAVYDLGAVLIPGG 532 A++FTLLPEWTTW LLV +A+YD+ AVL+P G Sbjct: 176 AYFFTLLPEWTTWVLLVALALYDIAAVLLPVG 207
>PSN1_XENLA (O12976) Presenilin-1 (EC 3.4.23.-) (Presenilin alpha) (PS-alpha)| Length = 433 Score = 39.7 bits (91), Expect = 0.005 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = +2 Query: 455 LPEWTTWALLVDMAVYDLGAVLIPGG 532 LPEWTTW +L ++VYDL AVL P G Sbjct: 207 LPEWTTWLILAVISVYDLVAVLSPKG 232
>PSN1_PONPY (Q5R780) Presenilin-1 (EC 3.4.23.-) (PS-1) [Contains: Presenilin-1| NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12)] Length = 467 Score = 38.1 bits (87), Expect = 0.015 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = +2 Query: 455 LPEWTTWALLVDMAVYDLGAVLIPGG 532 LPEWT W +L ++VYDL AVL P G Sbjct: 241 LPEWTAWLILAVISVYDLVAVLCPKG 266
>PSN1_MOUSE (P49769) Presenilin-1 (EC 3.4.23.-) (PS-1) (Protein S182)| [Contains: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12)] Length = 467 Score = 38.1 bits (87), Expect = 0.015 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = +2 Query: 455 LPEWTTWALLVDMAVYDLGAVLIPGG 532 LPEWT W +L ++VYDL AVL P G Sbjct: 241 LPEWTAWLILAVISVYDLVAVLCPKG 266
>PSN1_MICMU (P79802) Presenilin-1 (EC 3.4.23.-) (PS-1) [Contains: Presenilin-1| NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12)] Length = 467 Score = 38.1 bits (87), Expect = 0.015 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = +2 Query: 455 LPEWTTWALLVDMAVYDLGAVLIPGG 532 LPEWT W +L ++VYDL AVL P G Sbjct: 241 LPEWTAWLILAVISVYDLVAVLCPKG 266
>PSN1_MACFA (Q8HXW5) Presenilin-1 (EC 3.4.23.-) (PS-1) [Contains: Presenilin-1| NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12)] Length = 467 Score = 38.1 bits (87), Expect = 0.015 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = +2 Query: 455 LPEWTTWALLVDMAVYDLGAVLIPGG 532 LPEWT W +L ++VYDL AVL P G Sbjct: 241 LPEWTAWLILAVISVYDLVAVLCPKG 266
>PSN1_HUMAN (P49768) Presenilin-1 (EC 3.4.23.-) (PS-1) (Protein S182)| [Contains: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12)] Length = 467 Score = 38.1 bits (87), Expect = 0.015 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = +2 Query: 455 LPEWTTWALLVDMAVYDLGAVLIPGG 532 LPEWT W +L ++VYDL AVL P G Sbjct: 241 LPEWTAWLILAVISVYDLVAVLCPKG 266
>PSN1_BRARE (Q9W6T7) Presenilin-1 (EC 3.4.23.-) (PS1) (Zf-PS1)| Length = 456 Score = 38.1 bits (87), Expect = 0.015 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = +2 Query: 455 LPEWTTWALLVDMAVYDLGAVLIPGG 532 LPEWT W +L ++VYDL AVL P G Sbjct: 230 LPEWTAWLILAAISVYDLLAVLCPKG 255
>PSN1_BOVIN (Q9XT97) Presenilin-1 (EC 3.4.23.-) (PS-1) [Contains: Presenilin-1| NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12)] Length = 478 Score = 38.1 bits (87), Expect = 0.015 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = +2 Query: 455 LPEWTTWALLVDMAVYDLGAVLIPGG 532 LPEWT W +L ++VYDL AVL P G Sbjct: 242 LPEWTAWLILAVISVYDLVAVLCPKG 267
>PSN1_RAT (P97887) Presenilin-1 (EC 3.4.23.-) (PS-1) (Protein S182)| [Contains: Presenilin-1 NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12)] Length = 468 Score = 38.1 bits (87), Expect = 0.015 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = +2 Query: 455 LPEWTTWALLVDMAVYDLGAVLIPGG 532 LPEWT W +L ++VYDL AVL P G Sbjct: 241 LPEWTAWLILAVISVYDLVAVLCPKG 266
>PSN1_CHICK (Q4JIM4) Presenilin-1 (EC 3.4.23.-) (PS-2) [Contains: Presenilin-1| NTF subunit; Presenilin-1 CTF subunit] Length = 468 Score = 38.1 bits (87), Expect = 0.015 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = +2 Query: 455 LPEWTTWALLVDMAVYDLGAVLIPGG 532 LPEWT W +L ++VYDL AVL P G Sbjct: 242 LPEWTAWLILAVISVYDLVAVLCPKG 267
>PSN1_CANFA (Q6RH31) Presenilin-1 (EC 3.4.23.-) (PS-1) [Contains: Presenilin-1| NTF subunit; Presenilin-1 CTF subunit; Presenilin-1 CTF12 (PS1-CTF12)] Length = 466 Score = 38.1 bits (87), Expect = 0.015 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = +2 Query: 455 LPEWTTWALLVDMAVYDLGAVLIPGG 532 LPEWT W +L ++VYDL AVL P G Sbjct: 240 LPEWTAWLILAVISVYDLVAVLCPKG 265
>PSN_DROME (O02194) Presenilin homolog (EC 3.4.23.-) (dPS) (DmPS)| Length = 541 Score = 37.0 bits (84), Expect = 0.034 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = +2 Query: 455 LPEWTTWALLVDMAVYDLGAVLIPGG 532 LPEWT WA+L ++++DL AVL P G Sbjct: 263 LPEWTAWAVLAAISIWDLIAVLSPRG 288
>PSN2_RAT (O88777) Presenilin-2 (EC 3.4.23.-) (PS-2) [Contains: Presenilin-2| NTF subunit; Presenilin-2 CTF subunit] Length = 448 Score = 36.2 bits (82), Expect = 0.058 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +2 Query: 455 LPEWTTWALLVDMAVYDLGAVLIPGG 532 LPEW+ W +L ++VYDL AVL P G Sbjct: 247 LPEWSAWVILGAISVYDLVAVLCPKG 272
>PSN2_MOUSE (Q61144) Presenilin-2 (EC 3.4.23.-) (PS-2) [Contains: Presenilin-2| NTF subunit; Presenilin-2 CTF subunit] Length = 448 Score = 36.2 bits (82), Expect = 0.058 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +2 Query: 455 LPEWTTWALLVDMAVYDLGAVLIPGG 532 LPEW+ W +L ++VYDL AVL P G Sbjct: 247 LPEWSAWVILGAISVYDLVAVLCPKG 272
>PSN2_HUMAN (P49810) Presenilin-2 (EC 3.4.23.-) (PS-2) (STM-2) (E5-1) (AD3LP)| (AD5) [Contains: Presenilin-2 NTF subunit; Presenilin-2 CTF subunit] Length = 448 Score = 36.2 bits (82), Expect = 0.058 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +2 Query: 455 LPEWTTWALLVDMAVYDLGAVLIPGG 532 LPEW+ W +L ++VYDL AVL P G Sbjct: 247 LPEWSAWVILGAISVYDLVAVLCPKG 272
>PSN2_MICMU (P79801) Presenilin-2 (EC 3.4.23.-) (PS-2) [Contains: Presenilin-2| NTF subunit; Presenilin-2 CTF subunit] (Fragment) Length = 445 Score = 36.2 bits (82), Expect = 0.058 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +2 Query: 455 LPEWTTWALLVDMAVYDLGAVLIPGG 532 LPEW+ W +L ++VYDL AVL P G Sbjct: 247 LPEWSAWVILGAISVYDLVAVLCPKG 272
>PSN2_BOVIN (Q9XT96) Presenilin-2 (EC 3.4.23.-) (PS-2) [Contains: Presenilin-2| NTF subunit; Presenilin-2 CTF subunit] Length = 449 Score = 36.2 bits (82), Expect = 0.058 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +2 Query: 455 LPEWTTWALLVDMAVYDLGAVLIPGG 532 LPEW+ W +L ++VYDL AVL P G Sbjct: 248 LPEWSAWVILGAISVYDLVAVLCPKG 273
>PSN2_XENLA (O12977) Presenilin-2 (EC 3.4.23.-) (Presenilin beta) (PS-beta)| Length = 449 Score = 35.8 bits (81), Expect = 0.075 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +2 Query: 455 LPEWTTWALLVDMAVYDLGAVLIPGG 532 LPEW+ W +L ++VYDL AVL P G Sbjct: 250 LPEWSAWVILGAISVYDLLAVLCPKG 275
>PSN2_CHICK (Q90X07) Presenilin-2 (EC 3.4.23.-) (PS-2) [Contains: Presenilin-2| NTF subunit; Presenilin-2 CTF subunit] Length = 451 Score = 35.4 bits (80), Expect = 0.098 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +2 Query: 455 LPEWTTWALLVDMAVYDLGAVLIPGG 532 LPEW+ W +L +++YDL AVL P G Sbjct: 253 LPEWSAWVILGAISIYDLIAVLCPKG 278
>PSN2_BRARE (Q90ZE4) Presenilin-2 (EC 3.4.23.-) (PS2) (Zf-PS2) (Pre2)| Length = 441 Score = 35.4 bits (80), Expect = 0.098 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +2 Query: 455 LPEWTTWALLVDMAVYDLGAVLIPGG 532 LPEW+ W +L +++YDL AVL P G Sbjct: 246 LPEWSAWVILGAISIYDLIAVLCPKG 271
>PSN_CAEEL (P52166) Presenilin sel-12| Length = 444 Score = 35.0 bits (79), Expect = 0.13 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +2 Query: 455 LPEWTTWALLVDMAVYDLGAVLIPGG 532 LPEWT W +L ++V+DL AVL P G Sbjct: 210 LPEWTVWFVLFVISVWDLVAVLTPKG 235
>HOP1_CAEEL (O02100) Presenilin hop-1| Length = 358 Score = 33.1 bits (74), Expect = 0.49 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 440 FWFTLLPEWTTWALLVDMAVYDLGAVLIPGG 532 F +LP+WT W L ++ +D+ AVL P G Sbjct: 161 FILNILPDWTVWMALTAISFWDIVAVLTPCG 191
>VIAAT_RAT (O35458) Vesicular inhibitory amino acid transporter (GABA and| glycine transporter) (Vesicular GABA transporter) (rGVAT) (Solute carrier family 32 member 1) Length = 525 Score = 29.3 bits (64), Expect = 7.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 532 PTGDEDGSEVVDGHVHEQRPGGPL 461 P GDE V+G +H QR G PL Sbjct: 69 PCGDEGAEPPVEGDIHYQRGGAPL 92
>VIAAT_MOUSE (O35633) Vesicular inhibitory amino acid transporter (GABA and| glycine transporter) (Vesicular GABA transporter) (mVIAAT) (mVGAT) (Solute carrier family 32 member 1) Length = 525 Score = 29.3 bits (64), Expect = 7.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 532 PTGDEDGSEVVDGHVHEQRPGGPL 461 P GDE V+G +H QR G PL Sbjct: 69 PCGDEGAEAPVEGDIHYQRGGAPL 92 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,610,641 Number of Sequences: 219361 Number of extensions: 132933 Number of successful extensions: 507 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 506 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4085413911 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)