| Clone Name | bart55b10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GATA1_HUMAN (P15976) Erythroid transcription factor (GATA-bindin... | 30 | 5.3 | 2 | ATX2_MOUSE (O70305) Ataxin-2 (Spinocerebellar ataxia type 2 prot... | 30 | 6.9 | 3 | IGHA1_GORGO (P20758) Ig alpha-1 chain C region | 29 | 9.0 |
|---|
>GATA1_HUMAN (P15976) Erythroid transcription factor (GATA-binding factor 1)| (GATA-1) (Eryf1) (GF-1) (NF-E1 DNA-binding protein) Length = 413 Score = 30.0 bits (66), Expect = 5.3 Identities = 27/92 (29%), Positives = 33/92 (35%), Gaps = 11/92 (11%) Frame = +1 Query: 79 FFGXXXXXXXXXASSTYGGYDAYPSAADAYFQDGERLYRHA-----------RRRAPAWS 225 FF ASST +AA AY++D E YRH+ P S Sbjct: 33 FFPSGPEGLDAAASSTAPSTATAAAAALAYYRDAEA-YRHSPVFQVYPLLNCMEGIPGGS 91 Query: 226 DYASYFPGVHATQPAARKSTTPRPSPPACGPD 321 YA + G PA+ T SPP D Sbjct: 92 PYAGWAYGKTGLYPASTVCPTREDSPPQAVED 123
>ATX2_MOUSE (O70305) Ataxin-2 (Spinocerebellar ataxia type 2 protein homolog)| Length = 1285 Score = 29.6 bits (65), Expect = 6.9 Identities = 23/79 (29%), Positives = 33/79 (41%), Gaps = 22/79 (27%) Frame = +1 Query: 148 PSAADAYFQDGERLYRHARRR------------------APAWSDYASYFPGVHATQPAA 273 P A+D + +G R RR APA + + PGV A+ P + Sbjct: 66 PCASDCFGSNGHGASRPGSRRLLGVCGPPRPFVVVLLALAPAATPARACPPGVRASPPRS 125 Query: 274 RKSTTPRPSP----PACGP 318 S++ RP+P PAC P Sbjct: 126 GVSSSARPAPGCPRPACEP 144
>IGHA1_GORGO (P20758) Ig alpha-1 chain C region| Length = 353 Score = 29.3 bits (64), Expect = 9.0 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 250 VHATQPAARKSTTPRPSPPACGP 318 V +T P ST P PSPP C P Sbjct: 103 VPSTPPTPSPSTPPTPSPPCCHP 125 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.132 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,088,069 Number of Sequences: 219361 Number of extensions: 631084 Number of successful extensions: 2373 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2256 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2365 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5196311029 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)