| Clone Name | bart54e02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PRPH_MESAU (P06680) Acidic proline-rich protein HP43A precursor | 32 | 1.3 | 2 | VID21_ASPFU (Q4WP03) Chromatin modification-related protein vid21 | 30 | 3.6 | 3 | KCNK4_HUMAN (Q9NYG8) Potassium channel subfamily K member 4 (TWI... | 30 | 3.6 | 4 | RS10B_ARATH (Q9FFS8) 40S ribosomal protein S10-2 | 30 | 4.8 | 5 | VID21_EMENI (Q5B4Q8) Chromatin modification-related protein vid21 | 29 | 8.1 |
|---|
>PRPH_MESAU (P06680) Acidic proline-rich protein HP43A precursor| Length = 183 Score = 32.0 bits (71), Expect = 1.3 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 5/49 (10%) Frame = -3 Query: 374 EPDGERRGGQRDGVEQQHGEHGAL-----AQEQHLPQRQGEGKARPPFP 243 + DGE G +G QQ G+H +Q PQ++G+ + RPP P Sbjct: 57 DDDGEEDGNAPEGPPQQGGDHQKPRPPKPGNQQGPPQQEGQQQNRPPKP 105
>VID21_ASPFU (Q4WP03) Chromatin modification-related protein vid21| Length = 1467 Score = 30.4 bits (67), Expect = 3.6 Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 2/79 (2%) Frame = -3 Query: 347 QRDGVEQQHGEHGALAQEQHLPQRQGE--GKARPPFPRRFCTTGRRIDHEAS*QRLTLLL 174 QR + QQ Q+Q Q+ G G+A+PP RR T R+D S + L LL Sbjct: 956 QRTVLAQQQAAQQQQQQQQQQQQQGGNNSGQAQPPIRRR-TTQPVRVDRRRSSKHLALL- 1013 Query: 173 RWVSDGRSARRLVTKRELL 117 + R+L KRE + Sbjct: 1014 ------DAMRKLAKKRETM 1026
>KCNK4_HUMAN (Q9NYG8) Potassium channel subfamily K member 4 (TWIK-related| arachidonic acid-stimulated potassium channel protein) (TRAAK) (Two pore K(+) channel KT4.1) Length = 393 Score = 30.4 bits (67), Expect = 3.6 Identities = 17/41 (41%), Positives = 19/41 (46%) Frame = +3 Query: 75 PHIPPLPCPAQSLS**FSLRHEPPRAPTVANPPQQES*SLL 197 P +PP PCPAQ L R P P A PP + S L Sbjct: 302 PLLPPPPCPAQPLG-----RPRSPSPPEKAQPPSPPTASAL 337
>RS10B_ARATH (Q9FFS8) 40S ribosomal protein S10-2| Length = 180 Score = 30.0 bits (66), Expect = 4.8 Identities = 24/56 (42%), Positives = 27/56 (48%), Gaps = 6/56 (10%) Frame = -3 Query: 389 PVAPREPDGERRGGQRDGVE---QQHGEHG--ALAQEQHLPQ-RQGEGKARPPFPR 240 P P DGERR G RDG + GE+G A A + P R G G AR F R Sbjct: 110 PRGPPRGDGERRFGDRDGYRGGPKSGGEYGDKAGAPADYQPGFRGGAGGARQGFGR 165
>VID21_EMENI (Q5B4Q8) Chromatin modification-related protein vid21| Length = 1447 Score = 29.3 bits (64), Expect = 8.1 Identities = 29/89 (32%), Positives = 41/89 (46%), Gaps = 3/89 (3%) Frame = -3 Query: 347 QRDGVEQQHGEHGALAQEQHLPQRQGE-GKARPPFP--RRFCTTGRRIDHEAS*QRLTLL 177 QR+ + QQ A Q+Q Q+QG G + P P RR T R+D S + L LL Sbjct: 920 QRNVMAQQ----AAAQQQQQQQQQQGSNGNNQQPMPLIRRRGTQPIRVDRRRSSKHLALL 975 Query: 176 LRWVSDGRSARRLVTKRELLGERLGRAGQ 90 + R+L KRE + ++ A Q Sbjct: 976 -------DAMRKLAKKRETILQKQQHASQ 997 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,368,500 Number of Sequences: 219361 Number of extensions: 1244065 Number of successful extensions: 4424 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4411 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4700377760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)