| Clone Name | bart54b03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATG1_KLULA (Q6CSX2) Serine/threonine-protein kinase ATG1 (EC 2.7... | 32 | 1.2 | 2 | ARGJ_PSYAR (Q4FSF9) Arginine biosynthesis bifunctional protein a... | 29 | 7.8 |
|---|
>ATG1_KLULA (Q6CSX2) Serine/threonine-protein kinase ATG1 (EC 2.7.11.1)| (Autophagy-related protein 1) Length = 831 Score = 32.0 bits (71), Expect = 1.2 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 6/47 (12%) Frame = +3 Query: 84 SVLLFVYSQHNTNAIAS------VSPQLLRELSRPCVLRGDRPHTPW 206 SV LF Y QHNT A +S ++PQ+ +EL+ VLR D P+ Sbjct: 511 SVRLFGY-QHNTKATSSPPQQTLLNPQIFQELTENAVLRADHKLNPF 556
>ARGJ_PSYAR (Q4FSF9) Arginine biosynthesis bifunctional protein argJ [Includes:| Glutamate N-acetyltransferase (EC 2.3.1.35) (Ornithine acetyltransferase) (Ornithine transacetylase) (OATase); Amino-acid acetyltransferase (EC 2.3.1.1) (N-acetylglutamate syn Length = 407 Score = 29.3 bits (64), Expect = 7.8 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = -1 Query: 558 HLTSGLPRMISLNNVSAKLRVSADSKEGSRDFCGGPASIAPLRNSTFL 415 H PR + N +A AD K + D C A+ A + N+T L Sbjct: 66 HFAKASPRYLVTNTGNANAGTGADGKRRAIDICAALAAKAGVNNNTVL 113 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,990,798 Number of Sequences: 219361 Number of extensions: 904554 Number of successful extensions: 2535 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2535 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4528412720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)