| Clone Name | bart54a12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ABI3_MOUSE (Q8BYZ1) ABI gene family member 3 (New molecule inclu... | 30 | 5.8 | 2 | IR04_HCMVA (P09694) Hypothetical protein IRL4 (TRL4) | 29 | 7.6 | 3 | CT012_MACFA (Q9GKS9) Protein C20orf12 homolog | 29 | 7.6 | 4 | Y3456_PSEAE (Q9HYF0) UPF0209 protein PA3456 | 29 | 9.9 | 5 | CT012_HUMAN (Q9NVP4) Protein C20orf12 | 29 | 9.9 |
|---|
>ABI3_MOUSE (Q8BYZ1) ABI gene family member 3 (New molecule including SH3)| (Nesh) Length = 367 Score = 29.6 bits (65), Expect = 5.8 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +3 Query: 12 PLFAPLFSPPSRLHVSRPLSRVRLPSPAP 98 PL A +F PP L VS+P LP P P Sbjct: 252 PLSAEVFLPPPPLEVSQPPLEAELPLPPP 280
>IR04_HCMVA (P09694) Hypothetical protein IRL4 (TRL4)| Length = 170 Score = 29.3 bits (64), Expect = 7.6 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 3 QHAPLFAPLFSPPSRLHVSRPLSRVRLPSPAPT 101 QHA ++ + SPPSRL + PL P P P+ Sbjct: 2 QHARVYVCIASPPSRLPSAVPLPPPPAPPPLPS 34
>CT012_MACFA (Q9GKS9) Protein C20orf12 homolog| Length = 606 Score = 29.3 bits (64), Expect = 7.6 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +2 Query: 8 RTAFCTTLFPSLPSARFAPSFTSPV--TFTCTHPPLQGKEYG 127 + A C PS P ARF SPV F C PP +G + G Sbjct: 58 KCAHCLAPCPSDPFARFCQECGSPVPPIFGCRLPPPEGAQMG 99
>Y3456_PSEAE (Q9HYF0) UPF0209 protein PA3456| Length = 654 Score = 28.9 bits (63), Expect = 9.9 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 112 RERIRRRNKGESSSAGRPWRAPPPPH 189 RE + +G ++AG+PW A P PH Sbjct: 227 REMLSGTYQGPPANAGKPWYARPAPH 252
>CT012_HUMAN (Q9NVP4) Protein C20orf12| Length = 579 Score = 28.9 bits (63), Expect = 9.9 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +2 Query: 8 RTAFCTTLFPSLPSARFAPSFTSPV--TFTCTHPPLQGKEYG 127 + A C PS P ARF SPV F C PP +G + G Sbjct: 37 KCAHCLAPRPSDPFARFCQECGSPVPPIFGCRLPPPEGAQMG 78 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,485,095 Number of Sequences: 219361 Number of extensions: 823039 Number of successful extensions: 3425 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3242 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3419 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4373119116 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)