| Clone Name | bart53h01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TERT_HUMAN (O14746) Telomerase reverse transcriptase (EC 2.7.7.4... | 27 | 8.9 | 2 | POLG_DEN1S (P33478) Genome polyprotein [Contains: Capsid protein... | 27 | 8.9 | 3 | DCUP_AQUAE (O66667) Uroporphyrinogen decarboxylase (EC 4.1.1.37)... | 27 | 8.9 |
|---|
>TERT_HUMAN (O14746) Telomerase reverse transcriptase (EC 2.7.7.49) (Telomerase| catalytic subunit) (HEST2) (Telomerase-associated protein 2) (TP2) Length = 1132 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 376 PDPAAAASRRRVGGCHQGRSWRRRSQGLPLRVSAVGA 266 P P A+ RRR+G C + + R G+PL + A GA Sbjct: 186 PPPHASGPRRRLG-CERAWNHSVREAGVPLGLPAPGA 221
>POLG_DEN1S (P33478) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3396 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 7/30 (23%) Frame = -1 Query: 403 PRWLSERSFPDPAA-------AASRRRVGG 335 PRWL R++ DP A AA RR V G Sbjct: 2068 PRWLDARTYSDPLALREFKEFAAGRRSVSG 2097
>DCUP_AQUAE (O66667) Uroporphyrinogen decarboxylase (EC 4.1.1.37) (URO-D) (UPD)| Length = 338 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 396 GFLSAPFRTLLLLLPGGASED 334 GF APF L L+ GGAS+D Sbjct: 135 GFAGAPFTLLSYLIEGGASKD 155 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,716,362 Number of Sequences: 219361 Number of extensions: 551931 Number of successful extensions: 1332 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1332 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)