| Clone Name | bart51e05 |
|---|---|
| Clone Library Name | barley_pub |
>S6A18_HUMAN (Q96N87) Sodium- and chloride-dependent transporter XTRP2 (Solute| carrier family 6 member 18) Length = 628 Score = 29.3 bits (64), Expect = 5.2 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 133 VLMLLPLIYAPVLPLIRIGLRHNPVWRDR 219 +L LLP+++ PV L ++ R WRDR Sbjct: 573 LLSLLPVLWVPVAALAQLLTRRRRTWRDR 601
>RNPA_THEFI (Q7X5L2) Ribonuclease P protein component (EC 3.1.26.5) (RNaseP| protein) (RNase P protein) (Protein C5) Length = 240 Score = 29.3 bits (64), Expect = 5.2 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = -3 Query: 249 ECAGEDAVEEAVPPHRVMPQPDPDEGQNGG 160 E A A E A PPHRV+P P P Q+GG Sbjct: 30 EGAEAQAAEGAPPPHRVIP-PHPGLRQDGG 58
>CHLD_SYNY3 (P72772) Magnesium-chelatase subunit chlD (EC 6.6.1.1)| (Mg-protoporphyrin IX chelatase) (Mg-chelatase subunit D) Length = 676 Score = 28.9 bits (63), Expect = 6.8 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 213 PPHRVMPQPDPDEGQNGGVDEREQHQ 136 PP + P P P + Q+ G DE+E Q Sbjct: 335 PPEQAPPPPPPPQNQDEGKDEQEDQQ 360
>PP2B2_DROME (Q27889) Serine/threonine-protein phosphatase 2B catalytic subunit| 2, (EC 3.1.3.16) (Calmodulin-dependent calcineurin A2 subunit) Length = 570 Score = 28.5 bits (62), Expect = 8.9 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -3 Query: 270 YEVGAMYECAGEDAVEEAVPPHRVMPQPDPDEGQN 166 +++ + E G DAV E +PP R P P P E N Sbjct: 523 HKITSFAEAKGLDAVNERMPPRRDQP-PTPSEDPN 556
>LAMC1_DROME (P15215) Laminin gamma-1 chain precursor (Laminin B2 chain)| Length = 1639 Score = 28.5 bits (62), Expect = 8.9 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +3 Query: 252 TWHLPHIRTVRRGEQVNHALQSSSYEFATAIYDD--CKSTIDEGVTGFSY 395 T+ LP R +R+GE HAL +S Y + + D ST++ +G ++ Sbjct: 198 TYSLPDSRAIRKGEGEAHALCTSEYSDISPLRDGEIAFSTLEGRPSGINF 247 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,298,605 Number of Sequences: 219361 Number of extensions: 836390 Number of successful extensions: 1998 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1967 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1997 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)