| Clone Name | bart51c01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FAS_HUMAN (P49327) Fatty acid synthase (EC 2.3.1.85) [Includes: ... | 30 | 3.5 | 2 | CCSA_ODOSI (P49523) Cytochrome c biogenesis protein ccsA | 30 | 3.5 | 3 | SGO1_YEAST (Q08490) Shugoshin | 28 | 7.7 | 4 | CCSA_CYAPA (P48257) Cytochrome c biogenesis protein ccsA | 28 | 7.7 |
|---|
>FAS_HUMAN (P49327) Fatty acid synthase (EC 2.3.1.85) [Includes:| [Acyl-carrier-protein] S-acetyltransferase (EC 2.3.1.38); [Acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39); 3-oxoacyl-[acyl-carrier-protein] synthase (EC 2.3.1.41); 3-oxoacyl-[acyl- Length = 2511 Score = 29.6 bits (65), Expect = 3.5 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 7/50 (14%) Frame = -1 Query: 137 EGSSDWR-------FGVCVGLARPLRIPISAGHRGRDLYRKSWQGQRTGR 9 E S+DWR G+ G+ RPL+ + G + D +R QG+ G+ Sbjct: 1802 ESSADWREVWALVQAGIRDGVVRPLKCTVFHGAQVEDAFRYMAQGKHIGK 1851
>CCSA_ODOSI (P49523) Cytochrome c biogenesis protein ccsA| Length = 312 Score = 29.6 bits (65), Expect = 3.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -2 Query: 142 GKRAARIGDLGFALVWLARFGYRFL 68 GK+ A +G LGF ++W+ G FL Sbjct: 277 GKKTAILGGLGFFVIWICYLGVNFL 301
>SGO1_YEAST (Q08490) Shugoshin| Length = 590 Score = 28.5 bits (62), Expect = 7.7 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +3 Query: 9 PTRSLPLPRFAIQIAAAVTSRNR---YPKRASQTNANPKSPIRAALFP 143 P+ LPLP T+ + YP +S TN++PK+ I+ ++ P Sbjct: 291 PSNPLPLPLPGPSATLPTTTSDASTVYPSSSSSTNSHPKTKIKHSMKP 338
>CCSA_CYAPA (P48257) Cytochrome c biogenesis protein ccsA| Length = 322 Score = 28.5 bits (62), Expect = 7.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 142 GKRAARIGDLGFALVWLARFGYRFL 68 GK+AA + LGF ++W+ G L Sbjct: 287 GKKAAMVASLGFFIIWICYLGVNLL 311 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,080,034 Number of Sequences: 219361 Number of extensions: 843789 Number of successful extensions: 2450 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2402 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2450 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)