| Clone Name | bart51a06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ROM1_YEAST (P53046) RHO1 GDP-GTP exchange protein 1 (Protein kin... | 30 | 2.4 | 2 | COG1_MOUSE (Q9Z160) Conserved oligomeric Golgi complex component... | 29 | 5.3 | 3 | CORIN_HUMAN (Q9Y5Q5) Atrial natriuteric peptide-converting enzym... | 28 | 9.0 | 4 | VRP1_YEAST (P37370) Verprolin | 28 | 9.0 | 5 | ATT_APLFA (Q7M459) Attractin | 28 | 9.0 | 6 | SYD_THEAC (Q9HJM1) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspar... | 28 | 9.0 |
|---|
>ROM1_YEAST (P53046) RHO1 GDP-GTP exchange protein 1 (Protein kinase C| suppressor SKC1) Length = 1155 Score = 30.0 bits (66), Expect = 2.4 Identities = 29/115 (25%), Positives = 46/115 (40%), Gaps = 13/115 (11%) Frame = -3 Query: 399 KSSGISLA-PVRAPTYPTPLKSFHKVGLESS--------STGSSFPADSAKPVPLAVVSL 247 K+SG + P + T PTP + H + L SS ST S F +S K + Sbjct: 163 KNSGSHMGDPNQLSTPPTPKSAGHTMELHSSFNGKHSSSSTSSLFALESLKTQNRRSSNS 222 Query: 246 DSRQGQWESR*SIHARH*LDDE----AFGYLKRVIVTPAVYPRLVEFLHFDIQST 94 + Q+ + H RH + + + + TP VYP L+ + + T Sbjct: 223 SNHSSQYRRHTNQHQRHHSRSKSSPVSLTEISMIKGTPLVYPALLSLIAIKFKQT 277
>COG1_MOUSE (Q9Z160) Conserved oligomeric Golgi complex component 1 (Low| density lipoprotein receptor defect B-complementing protein) Length = 980 Score = 28.9 bits (63), Expect = 5.3 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 232 SLSTIQRNHSQGNGLGGISGERRPC 306 +L T+ R H G G+G + GE + C Sbjct: 293 TLETVTRQHPTGKGIGALQGEMKLC 317
>CORIN_HUMAN (Q9Y5Q5) Atrial natriuteric peptide-converting enzyme (EC 3.4.21.-)| (pro-ANP-converting enzyme) (Corin) (Heart-specific serine proteinase ATC2) (Transmembrane protease, serine 10) Length = 1042 Score = 28.1 bits (61), Expect = 9.0 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +3 Query: 6 WYGQGESDCLIKTKHCDGPRGC*RNVISAQCSECQSEEIQ 125 W CL T CDG C + CS CQ +E++ Sbjct: 622 WECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELE 661
>VRP1_YEAST (P37370) Verprolin| Length = 817 Score = 28.1 bits (61), Expect = 9.0 Identities = 20/62 (32%), Positives = 27/62 (43%) Frame = -3 Query: 423 PRNK*NNVKSSGISLAPVRAPTYPTPLKSFHKVGLESSSTGSSFPADSAKPVPLAVVSLD 244 P ++ + KSS ISL V AP P+ S T S P + P P + LD Sbjct: 201 PAHRSHQRKSSNISLPSVSAPPLPS----------ASLPTHVSNPPQAPPPPPTPTIGLD 250 Query: 243 SR 238 S+ Sbjct: 251 SK 252
>ATT_APLFA (Q7M459) Attractin| Length = 58 Score = 28.1 bits (61), Expect = 9.0 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 5/47 (10%) Frame = +3 Query: 12 GQGESDCLIKTKHCDGPRGC*RNVISAQC-----SECQSEEIQPSAG 137 G S C ++ ++CD GC N I +C CQ++E + ++G Sbjct: 7 GNITSQCEMQHQNCDDANGC--NTIIEECKTSMVERCQNQEFESASG 51
>SYD_THEAC (Q9HJM1) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA| ligase) (AspRS) Length = 428 Score = 28.1 bits (61), Expect = 9.0 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -3 Query: 342 KSFHKVGLESSSTGSSFPADSAKPVPLAVVSLDSRQGQWESR 217 KS K G+E S T S ++ P+PL VV D Q E+R Sbjct: 77 KSISKAGIEISGTSISIVNEAEAPLPLPVV--DPVQADLETR 116 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,503,794 Number of Sequences: 219361 Number of extensions: 1106507 Number of successful extensions: 2644 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2555 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2643 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)