| Clone Name | bart50h01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LEU3_SYNP6 (Q5MZ40) 3-isopropylmalate dehydrogenase (EC 1.1.1.85... | 30 | 3.0 | 2 | H5_COLLI (P02260) Histone H5 (Fragment) | 29 | 5.2 | 3 | ADA2B_BRARE (Q90WY5) Alpha-2B adrenergic receptor (Alpha-2B adre... | 28 | 6.7 | 4 | PTSBC_BACSU (P05306) PTS system sucrose-specific EIIBC component... | 28 | 6.7 |
|---|
>LEU3_SYNP6 (Q5MZ40) 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (Beta-IPM| dehydrogenase) (IMDH) (3-IPM-DH) Length = 365 Score = 29.6 bits (65), Expect = 3.0 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 292 GLYHQSSVRKVDLQTGKVLDQHQMDGHMFGEGLTLLG 402 GL + +++ +VLDQ G ++ EG+TL+G Sbjct: 311 GLDEPEAAARIEAAVNQVLDQGYRTGDLYSEGMTLVG 347
>H5_COLLI (P02260) Histone H5 (Fragment)| Length = 38 Score = 28.9 bits (63), Expect = 5.2 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 4 APIPLSVPAPSASPTSWRLRRRP 72 +PIP+ PAP+A P R+ +RP Sbjct: 3 SPIPVPAPAPAAKPKPKRVSKRP 25
>ADA2B_BRARE (Q90WY5) Alpha-2B adrenergic receptor (Alpha-2B adrenoceptor)| (Alpha-2B adrenoreceptor) (Alpha(2B)AR) Length = 510 Score = 28.5 bits (62), Expect = 6.7 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +2 Query: 224 PTTPRPSPRVSCTEETAPSSS 286 PTTP PSP S + E APS S Sbjct: 307 PTTPCPSPSPSNSSEVAPSKS 327
>PTSBC_BACSU (P05306) PTS system sucrose-specific EIIBC component (EIIBC-Scr)| (EII-Scr) [Includes: Sucrose-specific phosphotransferase enzyme IIB component (EC 2.7.1.69) (PTS system sucrose-specific EIIB component); Sucrose permease IIC component (PTS sys Length = 461 Score = 28.5 bits (62), Expect = 6.7 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 220 YPHDPEAFTQGLLYGGNGTLFESTGLYH 303 Y +D F GL++GG +L TG++H Sbjct: 284 YVYDHAGFVAGLIFGGTYSLIVLTGVHH 311 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,419,915 Number of Sequences: 219361 Number of extensions: 734020 Number of successful extensions: 3228 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3217 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)