| Clone Name | bart50d12 |
|---|---|
| Clone Library Name | barley_pub |
>CACB1_MOUSE (Q8R3Z5) Voltage-dependent L-type calcium channel beta-1 subunit| (CAB1) (Calcium channel, voltage-dependent, beta 1 subunit) Length = 597 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 16 HPTPSLPPVAVAQRAKSTSGLAAWPGP 96 HP S PP + R +T+ LAA P P Sbjct: 413 HPPSSTPPNPLLNRTMATAALAASPAP 439
>CACB1_RABIT (P19517) Voltage-dependent L-type calcium channel beta-1 subunit| (CAB1) (Calcium channel, voltage-dependent, beta 1 subunit) Length = 524 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 16 HPTPSLPPVAVAQRAKSTSGLAAWPGP 96 HP S PP + R +T+ LAA P P Sbjct: 458 HPPSSTPPNPLLNRTMATAALAASPAP 484
>CACB1_HUMAN (Q02641) Voltage-dependent L-type calcium channel beta-1 subunit| (CAB1) (Calcium channel, voltage-dependent, beta 1 subunit) Length = 598 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 16 HPTPSLPPVAVAQRAKSTSGLAAWPGP 96 HP S PP + R +T+ LAA P P Sbjct: 413 HPPSSTPPNPLLNRTMATAALAASPAP 439
>CACB1_BOVIN (Q9MZL7) Voltage-dependent L-type calcium channel beta-1 subunit| (CAB1) (Calcium channel, voltage-dependent, beta 1 subunit) Length = 598 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 16 HPTPSLPPVAVAQRAKSTSGLAAWPGP 96 HP S PP + R +T+ LAA P P Sbjct: 413 HPPSSTPPNPLLNRTMATAALAASPAP 439
>RANB9_MOUSE (P69566) Ran-binding protein 9 (RanBP9) (Ran-binding protein M)| (RanBPM) (B cell antigen receptor Ig beta-associated protein 1) (IBAP-1) Length = 653 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 19 PTPSLPPVAVAQRAKSTSGLAAWPGP 96 P P PP + A A + GLA PGP Sbjct: 14 PPPPPPPASAAAPATAPPGLAVGPGP 39
>SRR_MOUSE (Q9QZX7) Serine racemase (EC 5.1.1.-)| Length = 339 Score = 27.3 bits (59), Expect = 9.8 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +1 Query: 1 SKFDHHPTPSL-PPVAVAQRAKSTSGLAAWP 90 SK TP+L PP +A KS+ GL WP Sbjct: 220 SKLKGELTPNLHPPETIADGVKSSIGLNTWP 250 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,269,687 Number of Sequences: 219361 Number of extensions: 242150 Number of successful extensions: 835 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 834 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)