| Clone Name | bart50c01 |
|---|---|
| Clone Library Name | barley_pub |
>ZSWM5_MOUSE (Q80TC6) Zinc finger SWIM domain-containing protein 5| Length = 1188 Score = 29.3 bits (64), Expect = 2.3 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = -1 Query: 345 RSAPPAAFSGAHRGAGGVLAPRSRP 271 R P AA GA G GG LAP +RP Sbjct: 34 RGTPGAAGGGAGGGGGGCLAPGARP 58
>SPEG_MOUSE (Q62407) Striated muscle-specific serine/threonine protein kinase| (EC 2.7.11.1) (Aortic preferentially expressed protein 1) (APEG-1) Length = 3262 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 272 GRDLGARTPPAPRWAPEKAAGGADR 346 G D G R PP+P P++A GA R Sbjct: 9 GEDAGTRAPPSPGVPPKRAKVGAGR 33
>SPEG_RAT (Q63638) Striated muscle-specific serine/threonine protein kinase| (EC 2.7.11.1) (Aortic preferentially expressed protein 1) (APEG-1) Length = 3259 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 272 GRDLGARTPPAPRWAPEKAAGGADR 346 G D G R PP+P P++A GA R Sbjct: 9 GEDAGTRAPPSPGVPPKRAKVGAGR 33
>TBX1_MOUSE (P70323) T-box transcription factor TBX1 (T-box protein 1)| (Testis-specific T-box protein) Length = 479 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 4/21 (19%) Frame = +1 Query: 133 HHHPSSWP----DHHLAAKSR 183 HHHP +P DH+L AKSR Sbjct: 397 HHHPYKYPAAAYDHYLGAKSR 417
>SNTB2_HUMAN (Q13425) Beta-2-syntrophin (59 kDa dystrophin-associated protein| A1, basic component 2) (Syntrophin 3) (SNT3) (Syntrophin-like) (SNTL) Length = 540 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 266 SVGRDLGARTPPAPRWAPEKAAGGADRPQQEAVVKEVSKG 385 S R LG +PPAP P AG + ++ VVK+ + G Sbjct: 86 SPSRGLGPPSPPAPPRGPAGEAGASPPVRRVRVVKQEAGG 125
>HXB1_HUMAN (P14653) Homeobox protein Hox-B1 (Hox-2I)| Length = 301 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +2 Query: 284 GARTPPAPRWAPEKAAGGADRPQQEAVVKEVSKGAV 391 G R PPAP P++AAG A Q E S +V Sbjct: 265 GGRVPPAPPGCPKEAAGDAS-DQSTCTSPEASPSSV 299
>CRTY_ENTAG (Q01331) Lycopene cyclase| Length = 386 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 29 PSLAAGLEPLPAHAWPGCHGQLQRLMHGRSR 121 P A L PL AHAWPG Q L +R Sbjct: 53 PGQHAWLAPLVAHAWPGYEVQFPDLRRRLAR 83 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,954,190 Number of Sequences: 219361 Number of extensions: 555411 Number of successful extensions: 2564 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2560 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)