| Clone Name | bart50b01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EFP_MYCPA (Q741J3) Elongation factor P (EF-P) | 29 | 4.4 | 2 | ZBP2_CHICK (Q8UVD9) Zipcode-binding protein 2 | 28 | 7.6 | 3 | ERYA2_SACER (Q03132) Erythronolide synthase, modules 3 and 4 (EC... | 28 | 7.6 | 4 | DPYL3_XENLA (O13022) Dihydropyrimidinase-related protein 3 (DRP-... | 28 | 9.9 |
|---|
>EFP_MYCPA (Q741J3) Elongation factor P (EF-P)| Length = 187 Score = 29.3 bits (64), Expect = 4.4 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +2 Query: 185 FLVQPQPNQLTYHNGAVLRGDIPVSV 262 FL++ P Q+ +HNG+ L ++PVSV Sbjct: 104 FLLEGMPVQVAFHNGSPLYIELPVSV 129
>ZBP2_CHICK (Q8UVD9) Zipcode-binding protein 2| Length = 769 Score = 28.5 bits (62), Expect = 7.6 Identities = 16/55 (29%), Positives = 22/55 (40%) Frame = +1 Query: 46 NLFPRSKPLFLPSPNGQEKXXXXXGANGARR*HGSRVGYREHEEAHVPGPAPAEP 210 N +P+ +P P+P+ K N A GY H PGP P +P Sbjct: 608 NTYPQWQP---PAPHDPSKAAAAADPNAAW------AGYYSHYYQQPPGPVPGQP 653
>ERYA2_SACER (Q03132) Erythronolide synthase, modules 3 and 4 (EC 2.3.1.94) (ORF| 2) (6-deoxyerythronolide B synthase II) (DEBS 2) Length = 3566 Score = 28.5 bits (62), Expect = 7.6 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = -3 Query: 268 PEDGDGDVAAQHGAVVVRELVRLGLDQEHELPRA 167 PE D AA+HG + LVR L+QE ELP A Sbjct: 2702 PEGDDPRAAARHGVLWAAALVRRWLEQE-ELPGA 2734
>DPYL3_XENLA (O13022) Dihydropyrimidinase-related protein 3 (DRP-3)| (Neural-specific protein 1) Length = 571 Score = 28.1 bits (61), Expect = 9.9 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +2 Query: 191 VQPQPNQLTYHNGAVLRGDIPVSVLWYGRFTAAQKAIVSD 310 + P P Y N + GD+ V+ + F+ AQKAI D Sbjct: 307 LSPDPTTPDYINSLLASGDLQVTGSAHATFSTAQKAIGKD 346 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.136 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,783,291 Number of Sequences: 219361 Number of extensions: 596404 Number of successful extensions: 2249 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2076 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2224 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)