| Clone Name | bart50a11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FUT3_BOVIN (Q11126) Galactoside 3(4)-L-fucosyltransferase (EC 2.... | 28 | 9.5 | 2 | CYSP_SCHMA (P25792) Cathepsin B-like cysteine proteinase precurs... | 28 | 9.5 |
|---|
>FUT3_BOVIN (Q11126) Galactoside 3(4)-L-fucosyltransferase (EC 2.4.1.65) (Blood| group Lewis alpha-4-fucosyltransferase) (Lewis FT) (Fucosyltransferase 3) (FUCT-III) (FUTB) Length = 365 Score = 27.7 bits (60), Expect = 9.5 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 8 SYRRSTTIPTPDGRLDTTPTSPITLLSNLS 97 SYRR + I P G L+ P+ P+ L N+S Sbjct: 162 SYRRDSDIFMPYGWLEPWPSQPVETLLNIS 191
>CYSP_SCHMA (P25792) Cathepsin B-like cysteine proteinase precursor (EC| 3.4.22.-) (Antigen Sm31) Length = 340 Score = 27.7 bits (60), Expect = 9.5 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 7 IIQTVNNHPNAGWTA 51 II +N HPNAGW A Sbjct: 33 IISYINEHPNAGWRA 47 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.133 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,326,646 Number of Sequences: 219361 Number of extensions: 152127 Number of successful extensions: 691 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 691 length of database: 80,573,946 effective HSP length: 9 effective length of database: 78,599,697 effective search space used: 1886392728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)