| Clone Name | bart50a09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NUO6_SOLTU (P80729) NADH-ubiquinone oxidoreductase 11 kDa subuni... | 38 | 0.007 | 2 | DRE2B_ARATH (O82133) Dehydration-responsive element-binding prot... | 30 | 1.8 | 3 | HN_SENDO (Q88261) Hemagglutinin-neuraminidase (EC 3.2.1.18) (HN ... | 28 | 6.9 | 4 | RL24_PRUAV (Q9FUL4) 60S ribosomal protein L24 | 28 | 6.9 |
|---|
>NUO6_SOLTU (P80729) NADH-ubiquinone oxidoreductase 11 kDa subunit (EC 1.6.5.3)| (EC 1.6.99.3) (Complex I-11KD) (CI-11KD) (Fragment) Length = 19 Score = 37.7 bits (86), Expect = 0.007 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +1 Query: 82 GFIMEFAENLILRLMEDPE 138 GFIMEFAENLILR MEDP+ Sbjct: 1 GFIMEFAENLILRRMEDPK 19
>DRE2B_ARATH (O82133) Dehydration-responsive element-binding protein 2B (DREB2B| protein) Length = 330 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/65 (23%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Frame = +1 Query: 88 IMEFAENLILRLMEDPEQRDEAQRAHVYRMKERCERTKAAWALPLRPYGF-WTFDRFNSQ 264 ++EF + +++++ E+ + + + +E+ ++ L + YG+ W+ D N Q Sbjct: 211 LLEFEQQYWGQVLQEKEKPKQEEEEIQQQQQEQQQQQLQPDLLTVADYGWPWSNDIVNDQ 270 Query: 265 LSWDP 279 SWDP Sbjct: 271 TSWDP 275
>HN_SENDO (Q88261) Hemagglutinin-neuraminidase (EC 3.2.1.18) (HN protein)| (HANA protein) Length = 575 Score = 27.7 bits (60), Expect = 6.9 Identities = 19/67 (28%), Positives = 28/67 (41%), Gaps = 4/67 (5%) Frame = +1 Query: 112 ILRLMEDPEQRDEAQRAHVYRMKERCERT----KAAWALPLRPYGFWTFDRFNSQLSWDP 279 ++RL+E R E + + C+ T A PL P+ FW LS DP Sbjct: 121 VIRLIEKSCNRQE--------LTQLCDSTIAVHHAEGIAPLEPHSFWRCPAGEPYLSSDP 172 Query: 280 QISQAAG 300 ++S G Sbjct: 173 EVSLLPG 179
>RL24_PRUAV (Q9FUL4) 60S ribosomal protein L24| Length = 186 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +1 Query: 118 RLMEDPEQRDEAQRAHVYRMKERCERTK 201 R E PE RD A+ A + +KER ++TK Sbjct: 96 RRTEKPEVRDAAREAALREIKERIKKTK 123 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,417,504 Number of Sequences: 219361 Number of extensions: 305803 Number of successful extensions: 825 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 825 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)