| Clone Name | bart49c09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | OPGH_RALSO (Q8XVC2) Glucans biosynthesis glucosyltransferase H (... | 29 | 9.0 |
|---|
>OPGH_RALSO (Q8XVC2) Glucans biosynthesis glucosyltransferase H (EC 2.4.1.-)| Length = 862 Score = 28.9 bits (63), Expect = 9.0 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = -3 Query: 295 ERRLSSTTVEA-VRTSLRRAAGSGPRDDDDMSAMAPTRRLKRMNDAAPGLSHGDIGHHPS 119 ER L + + A R +LRR AG P D D ++ R L R++ A G + + S Sbjct: 33 ERYLEALPLPAEARAALRREAGIEPADKDAVALAKLHRALARLDAAQTASIEGSVPAYAS 92 Query: 118 SGA 110 G+ Sbjct: 93 IGS 95 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,989,639 Number of Sequences: 219361 Number of extensions: 802808 Number of successful extensions: 3318 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3212 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3316 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 3970331829 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)