| Clone Name | bart46d03 |
|---|---|
| Clone Library Name | barley_pub |
>PUB14_ARATH (Q8VZ40) E3 ubiquitin ligase PUB14 (EC 6.3.2.-) (Prototypical U-box| domain protein 14) Length = 632 Score = 68.6 bits (166), Expect = 1e-11 Identities = 36/72 (50%), Positives = 46/72 (63%) Frame = +3 Query: 66 LIPQVLVCPISLDLMSDPVTLLPTGQTYDRPSIRRWLAAGHRTCPVTMRPLPHHTSGGSD 245 +IP+ CPISL+LM DPV ++ TGQTY+R SI++WL AGH+TCP + L H Sbjct: 247 VIPEYFRCPISLELMKDPV-IVSTGQTYERSSIQKWLDAGHKTCPKSQETLLH------- 298 Query: 246 QSALLAPNRTLK 281 A L PN LK Sbjct: 299 --AGLTPNYVLK 308
>SPL11_ORYSA (Q64HA9) Spotted leaf protein 11 (Spotted leaf11) (Cell| death-related protein SPL11) Length = 694 Score = 63.5 bits (153), Expect = 4e-10 Identities = 31/71 (43%), Positives = 43/71 (60%) Frame = +3 Query: 69 IPQVLVCPISLDLMSDPVTLLPTGQTYDRPSIRRWLAAGHRTCPVTMRPLPHHTSGGSDQ 248 IP CPISL+LM DPV ++ TGQTY+R I +W+A+GH TCP T + + Sbjct: 273 IPDEFRCPISLELMKDPV-IVSTGQTYERACIEKWIASGHHTCPTTQQKM---------S 322 Query: 249 SALLAPNRTLK 281 ++ L PN L+ Sbjct: 323 TSALTPNYVLR 333
>STUB1_HUMAN (Q9UNE7) STIP1 homology and U box-containing protein 1 (EC 6.3.2.-)| (STIP1 homology and U-box-containing protein 1) (Carboxy terminus of Hsp70-interacting protein) (E3 ubiquitin protein ligase CHIP) (CLL-associated antigen KW-8) (Antigen NY-C Length = 303 Score = 33.9 bits (76), Expect = 0.32 Identities = 21/50 (42%), Positives = 25/50 (50%) Frame = +3 Query: 69 IPQVLVCPISLDLMSDPVTLLPTGQTYDRPSIRRWLAAGHRTCPVTMRPL 218 IP L IS +LM +P + P+G TYDR I L PVT PL Sbjct: 227 IPDYLCGKISFELMREPC-ITPSGITYDRKDIEEHLQRVGHFDPVTRSPL 275
>STUB1_MOUSE (Q9WUD1) STIP1 homology and U box-containing protein 1 (EC 6.3.2.-)| (STIP1 homology and U-box-containing protein 1) (Carboxy terminus of Hsp70-interacting protein) (E3 ubiquitin protein ligase CHIP) Length = 304 Score = 33.9 bits (76), Expect = 0.32 Identities = 21/50 (42%), Positives = 25/50 (50%) Frame = +3 Query: 69 IPQVLVCPISLDLMSDPVTLLPTGQTYDRPSIRRWLAAGHRTCPVTMRPL 218 IP L IS +LM +P + P+G TYDR I L PVT PL Sbjct: 228 IPDYLCGKISFELMREPC-ITPSGITYDRKDIEEHLQRVGHFDPVTRSPL 276
>STUB1_CHICK (Q5ZHY5) STIP1 homology and U box-containing protein 1 (EC 6.3.2.-)| (STIP1 homology and U-box-containing protein 1) Length = 314 Score = 33.9 bits (76), Expect = 0.32 Identities = 21/50 (42%), Positives = 25/50 (50%) Frame = +3 Query: 69 IPQVLVCPISLDLMSDPVTLLPTGQTYDRPSIRRWLAAGHRTCPVTMRPL 218 IP L IS +LM +P + P+G TYDR I L PVT PL Sbjct: 238 IPDYLCGKISFELMREPC-ITPSGITYDRKDIEEHLQRVGHFDPVTRSPL 286
>RNF13_HUMAN (O43567) RING finger protein 13| Length = 381 Score = 32.3 bits (72), Expect = 0.93 Identities = 20/70 (28%), Positives = 28/70 (40%), Gaps = 3/70 (4%) Frame = +3 Query: 84 VCPISLDLMSD--PVTLLPTGQTYDRPSIRRWLAAGHRTCPV-TMRPLPHHTSGGSDQSA 254 VC I LD D + +LP Y + WL +TCPV + +P SD + Sbjct: 239 VCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSDSDTDS 298 Query: 255 LLAPNRTLKH 284 N +H Sbjct: 299 SQEENEVTEH 308
>ASR1_ASHGO (Q75DC2) Alcohol-sensitive RING finger protein 1| Length = 328 Score = 31.2 bits (69), Expect = 2.1 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +3 Query: 45 LESELTMLIPQVLVCPISLDLMSDPV-TLLPTGQTYDRPSIRRW--LAAGHRTCPV 203 + S + M PQ C I + M V L+P G Y IR+W L +G+R+CPV Sbjct: 5 ISSHIAMGCPQD-ECSICWESMPSGVGRLMPCGHEYHLACIRKWFHLHSGNRSCPV 59
>ZNF74_HUMAN (Q16587) Zinc finger protein 74 (hZNF7)| Length = 643 Score = 31.2 bits (69), Expect = 2.1 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 6/53 (11%) Frame = -2 Query: 344 EVVPERGQREVGEEEPAVDEVLER------AVGRQQGALIRAARCVVRQRAHG 204 + VP + Q+ + +EEPA + ++ER A GRQ GAL R+ R+ HG Sbjct: 119 KAVPSQ-QQGICKEEPAQEPIMERPLGGAQAWGRQAGALQRSQAAPGRRTCHG 170
>ICP0_BHV1K (P29836) Trans-acting transcriptional protein ICP0 (P135 protein)| (IER 2.9/ER2.6) Length = 676 Score = 31.2 bits (69), Expect = 2.1 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +3 Query: 72 PQVLVCPISLDLMSDPVTLLPTGQTYDRPSIRRWLAAGHRTCPVTMRPL 218 P++ C I LD ++ LP + IRRWL G TCP+ P+ Sbjct: 8 PELGSCCICLDAITGAARALPCLHAFCLACIRRWL-EGRPTCPLCKAPV 55
>ICP0_BHV1J (P29128) Trans-acting transcriptional protein ICP0 (P135 protein)| (IER 2.9/ER2.6) Length = 676 Score = 31.2 bits (69), Expect = 2.1 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +3 Query: 72 PQVLVCPISLDLMSDPVTLLPTGQTYDRPSIRRWLAAGHRTCPVTMRPL 218 P++ C I LD ++ LP + IRRWL G TCP+ P+ Sbjct: 8 PELGSCCICLDAITGAARALPCLHAFCLACIRRWL-EGRPTCPLCKAPV 55
>RNF13_MOUSE (O54965) RING finger protein 13| Length = 381 Score = 30.8 bits (68), Expect = 2.7 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 3/70 (4%) Frame = +3 Query: 84 VCPISLDLMSD--PVTLLPTGQTYDRPSIRRWLAAGHRTCPV-TMRPLPHHTSGGSDQSA 254 VC I L+ D + +LP Y + WL +TCPV + +P SD + Sbjct: 239 VCAICLEEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSDSDTDS 298 Query: 255 LLAPNRTLKH 284 N+ +H Sbjct: 299 SQEENQVSEH 308
>TRIM4_HUMAN (Q9C037) Tripartite motif protein 4 (RING finger protein 87)| Length = 500 Score = 30.4 bits (67), Expect = 3.5 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 10/59 (16%) Frame = +3 Query: 69 IPQVLVCPISLDLMSDPVTLLPTGQTYDRPSI-RRWLAAG---------HRTCPVTMRP 215 I + L CPI LD DPV+ + G + R + R W G H + P +RP Sbjct: 6 IQEELTCPICLDYFQDPVS-IECGHNFCRGCLHRNWAPGGGPFPCPECRHPSAPAALRP 63
>RP54_RHOSH (Q01194) RNA polymerase sigma-54 factor| Length = 434 Score = 30.4 bits (67), Expect = 3.5 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -2 Query: 281 LERAVGRQQGALIRAARCVVRQRA 210 LERAV R+Q L+R A C+VR +A Sbjct: 282 LERAVERRQATLLRTAVCLVRHQA 305
>LIRA2_HUMAN (Q8N149) Leukocyte immunoglobulin-like receptor subfamily A member| 2 precursor (Leucocyte immunoglobulin-like receptor 7) (LIR-7) (Immunoglobulin-like transcript 1) (ILT-1) (CD85h antigen) Length = 483 Score = 29.6 bits (65), Expect = 6.0 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +3 Query: 111 SDPVTLLPTGQTYDRPSI 164 SDP+ +L TGQ YDRPS+ Sbjct: 309 SDPLDILITGQFYDRPSL 326
>RBBP6_MOUSE (P97868) Retinoblastoma-binding protein 6 (p53-associated cellular| protein of testis) (Proliferation potential-related protein) (Protein P2P-R) Length = 1790 Score = 29.3 bits (64), Expect = 7.9 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 69 IPQVLVCPISLDLMSDPVTLLPTGQTYDRPSIR-RWLAAGHRTCP 200 IP L+C I D+M+D V + G +Y IR L + TCP Sbjct: 254 IPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCP 298
>RBBP6_HUMAN (Q7Z6E9) Retinoblastoma-binding protein 6 (p53-associated cellular| protein of testis) (Proliferation potential-related protein) (Protein P2P-R) (Retinoblastoma-binding Q protein 1) (Protein RBQ-1) Length = 1792 Score = 29.3 bits (64), Expect = 7.9 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 69 IPQVLVCPISLDLMSDPVTLLPTGQTYDRPSIR-RWLAAGHRTCP 200 IP L+C I D+M+D V + G +Y IR L + TCP Sbjct: 253 IPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCP 297 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,623,089 Number of Sequences: 219361 Number of extensions: 682786 Number of successful extensions: 2554 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 2520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2551 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4545742239 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)