| Clone Name | bart46b05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RCOR2_BRARE (Q6P116) REST corepressor 2 | 30 | 4.1 | 2 | PKNH_MYCTU (Q11053) Probable serine/threonine-protein kinase pkn... | 29 | 9.1 |
|---|
>RCOR2_BRARE (Q6P116) REST corepressor 2| Length = 536 Score = 30.4 bits (67), Expect = 4.1 Identities = 18/54 (33%), Positives = 23/54 (42%) Frame = +3 Query: 315 HHRGAFSGPGEVRDHPAFDVVPPSLPAGKRKSPGMLSWRRSRSRTPTHAQTPTP 476 +H A S P + P PPS P + P L R ++RTP H P P Sbjct: 440 NHSSAQSSPPLTQPPPLLRPAPPSAPPSLLRQPPPLQTRPLQNRTP-HNHPPPP 492
>PKNH_MYCTU (Q11053) Probable serine/threonine-protein kinase pknH (EC| 2.7.11.1) Length = 626 Score = 29.3 bits (64), Expect = 9.1 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 3/49 (6%) Frame = +3 Query: 339 PGEVRDHPAFDVVPPSLP--AGKRKSP-GMLSWRRSRSRTPTHAQTPTP 476 P V+ P PP+ P AG+R P G SW + P TPTP Sbjct: 325 PPGVQPAPKPSYTPPAQPGPAGQRPGPTGQPSWAPNSGPMPASGPTPTP 373 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,664,417 Number of Sequences: 219361 Number of extensions: 831125 Number of successful extensions: 3072 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3072 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5253413348 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)