| Clone Name | bart43g05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ERG1_ASHGO (Q75F69) Squalene monooxygenase (EC 1.14.99.7) (Squal... | 29 | 8.6 | 2 | MURD_MYCPA (Q73YQ6) UDP-N-acetylmuramoylalanine--D-glutamate lig... | 29 | 8.6 |
|---|
>ERG1_ASHGO (Q75F69) Squalene monooxygenase (EC 1.14.99.7) (Squalene epoxidase)| (SE) Length = 497 Score = 29.3 bits (64), Expect = 8.6 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 207 EEEEQRHGCPGHPHGRFLDSCGALC 133 EE+E+ HG G HGRFL + A+C Sbjct: 139 EEDEREHGV-GFVHGRFLQNLRAIC 162
>MURD_MYCPA (Q73YQ6) UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC| 6.3.2.9) (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase) (D-glutamic acid-adding enzyme) Length = 489 Score = 29.3 bits (64), Expect = 8.6 Identities = 18/40 (45%), Positives = 22/40 (55%) Frame = +1 Query: 436 AAPGDGELRAALGASFPSLRFEIYPFRAEAVAGLISASVR 555 A PGD L A GASF +F Y R EA A + A++R Sbjct: 452 AKPGDTVLLAPAGASFD--QFAGYADRGEAFAAAVRAAIR 489 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,751,479 Number of Sequences: 219361 Number of extensions: 754167 Number of successful extensions: 2417 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2265 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2417 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)