| Clone Name | bart42h04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FBX27_MOUSE (Q6DIA9) F-box only protein 27 | 33 | 0.52 | 2 | FBX27_MACFA (Q9N0C8) F-box only protein 27 | 32 | 0.88 | 3 | FBX27_HUMAN (Q8NI29) F-box only protein 27 (F-box/G-domain prote... | 31 | 1.5 | 4 | RBL_XANFL (P23011) Ribulose bisphosphate carboxylase large chain... | 29 | 7.5 | 5 | PCBF_PROMA (Q9L8M1) Divinyl chlorophyll a/b light-harvesting pro... | 28 | 9.7 |
|---|
>FBX27_MOUSE (Q6DIA9) F-box only protein 27| Length = 280 Score = 32.7 bits (73), Expect = 0.52 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +3 Query: 39 VANLALSTPTPDPNRTTPMEEACEIARLPEELVSAALAHTSPR 167 ++ + TP PDP +E +++RLP EL+ L+H PR Sbjct: 5 ISRTRVPTPEPDP------QEVLDLSRLPPELLLLVLSHVPPR 41
>FBX27_MACFA (Q9N0C8) F-box only protein 27| Length = 280 Score = 32.0 bits (71), Expect = 0.88 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 51 ALSTPTPDPNRTTPMEEACEIARLPEELVSAALAHTSPR 167 A P P+P + EEA ++++LP EL+ L+H PR Sbjct: 10 AARVPAPEPE--SEPEEALDLSQLPPELLLVVLSHVPPR 46
>FBX27_HUMAN (Q8NI29) F-box only protein 27 (F-box/G-domain protein 5)| Length = 283 Score = 31.2 bits (69), Expect = 1.5 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 51 ALSTPTPDPNRTTPMEEACEIARLPEELVSAALAHTSPR 167 A P P+P EEA ++++LP EL+ L+H PR Sbjct: 10 AARVPAPEPEP----EEALDLSQLPPELLLVVLSHVPPR 44
>RBL_XANFL (P23011) Ribulose bisphosphate carboxylase large chain (EC| 4.1.1.39) (RuBisCO large subunit) Length = 488 Score = 28.9 bits (63), Expect = 7.5 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +3 Query: 372 VWLDRETGAKCYMLSARNLFIVWGDTPQYWTWIPLE 479 VW DR T A Y A + V G QY+ W+ E Sbjct: 74 VWTDRLTAADMYRAKAYKVEPVPGQPGQYFCWVAYE 109
>PCBF_PROMA (Q9L8M1) Divinyl chlorophyll a/b light-harvesting protein pcbF| Length = 354 Score = 28.5 bits (62), Expect = 9.7 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = -1 Query: 160 DVWA-SAAETSSSGRRAISQASSIGVVRFGSG 68 D WA +A+ T+ SGR S A+ G++ FG+G Sbjct: 12 DYWAGNASVTNRSGRFIASHAAHTGMIAFGAG 43 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,089,946 Number of Sequences: 219361 Number of extensions: 646740 Number of successful extensions: 2459 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2347 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2459 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)