| Clone Name | bart40h02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DFG10_YEAST (P40526) Protein DFG10 | 39 | 0.011 | 2 | SPL10_ARATH (Q8S9L0) Squamosa promoter-binding-like protein 10 | 29 | 8.5 | 3 | OCLN_RAT (Q6P6T5) Occludin | 29 | 8.5 | 4 | SPL11_ARATH (Q9FZK0) Squamosa promoter-binding-like protein 11 | 29 | 8.5 |
|---|
>DFG10_YEAST (P40526) Protein DFG10| Length = 253 Score = 38.9 bits (89), Expect = 0.011 Identities = 39/137 (28%), Positives = 50/137 (36%), Gaps = 8/137 (5%) Frame = +1 Query: 187 SLLAAFSSRGKTVRPSSSSK--------AKFTVPQKYFLHFYVVGVAVTTSLLLAICFYA 342 S L F GKT RP +SK KFTVP+ YF HFY + + L + Y Sbjct: 32 SCLPEFLQYGKTYRPKENSKYSSILERIKKFTVPKAYFSHFYYL-----ATFLSLVTLYF 86 Query: 343 YMKMTPLLAEPSSYSTIASHFIGSNSFSFGSVLSRTMEHKYRVWRTVFVLLLMEIQVLRR 522 Y K P+ VW ++ LRR Sbjct: 87 YPKF-PI-----------------------------------VW-------IIFGHSLRR 103 Query: 523 LYETENVFHYSPTARMH 573 LYET V HY+ +RM+ Sbjct: 104 LYETLYVLHYTSNSRMN 120
>SPL10_ARATH (Q8S9L0) Squamosa promoter-binding-like protein 10| Length = 396 Score = 29.3 bits (64), Expect = 8.5 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -1 Query: 387 GVTRWLCQQRCHFHICIEAYCKQQACCHRHSHH 289 G+ R CQQ FH E K+++C R SHH Sbjct: 211 GLERRFCQQCSRFHAVSEFDEKKRSCRKRLSHH 243
>OCLN_RAT (Q6P6T5) Occludin| Length = 523 Score = 29.3 bits (64), Expect = 8.5 Identities = 21/76 (27%), Positives = 34/76 (44%), Gaps = 5/76 (6%) Frame = +1 Query: 223 VRPSSSSKAKFTVPQKYFLHFYVVG-----VAVTTSLLLAICFYAYMKMTPLLAEPSSYS 387 VRP S A P+ LHFY + + + L++ +C + + LA +Y Sbjct: 35 VRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSMLVIVMCIAVFACVASTLAWDRAYG 94 Query: 388 TIASHFIGSNSFSFGS 435 T F GS ++ +GS Sbjct: 95 T--GIFGGSMNYPYGS 108
>SPL11_ARATH (Q9FZK0) Squamosa promoter-binding-like protein 11| Length = 393 Score = 29.3 bits (64), Expect = 8.5 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -1 Query: 387 GVTRWLCQQRCHFHICIEAYCKQQACCHRHSHH 289 G+ R CQQ FH E K+++C R SHH Sbjct: 210 GLERRFCQQCSRFHAVSEFDEKKRSCRKRLSHH 242 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,697,688 Number of Sequences: 219361 Number of extensions: 1329585 Number of successful extensions: 4141 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3912 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4130 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4929664480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)