| Clone Name | bart38h09 |
|---|---|
| Clone Library Name | barley_pub |
>FOXJ3_MOUSE (Q8BUR3) Forkhead box protein J3| Length = 623 Score = 31.6 bits (70), Expect = 1.5 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = +1 Query: 133 PHRPAGGSPDQPTASGRSPPH-LHPPPAQLI*GIHQWRHPRRSLSTPAGTGPP 288 P RP +P S PPH HPPP Q H HP T A PP Sbjct: 395 PQRPQHPAPHPQQHSQLQPPHSQHPPPHQ-----HIQHHPNHQHQTLAHQPPP 442
>ICP4_HHV11 (P08392) Trans-acting transcriptional protein ICP4 (Transcriptional| activator IE175) (Alpha-4 protein) Length = 1298 Score = 31.6 bits (70), Expect = 1.5 Identities = 28/107 (26%), Positives = 33/107 (30%), Gaps = 18/107 (16%) Frame = +1 Query: 13 PPAQLPSKSRHKMWAGHGVNXXXXXXXXXXXXXXX------------GPD*LPH----RP 144 PPAQ P + RH W + G D H R Sbjct: 160 PPAQPPRRRRHGRWRPSASSTSSDSGSSSSSSASSSSSSSDEDEDDDGNDAADHAREARA 219 Query: 145 AGGSPDQ--PTASGRSPPHLHPPPAQLI*GIHQWRHPRRSLSTPAGT 279 G P P A GR+PP PPP PR + TPA + Sbjct: 220 VGRGPSSAAPAAPGRTPPPPGPPPLS-----EAAPKPRAAARTPAAS 261
>PRP_PIG (Q95JC9) Basic proline-rich protein precursor [Contains:| Proline-rich peptide SP-A (PRP-SP-A); Proline-rich peptide SP-B (PRP-SP-B); Parotid hormone (PH-Ab)] Length = 676 Score = 31.2 bits (69), Expect = 1.9 Identities = 18/53 (33%), Positives = 20/53 (37%) Frame = +1 Query: 133 PHRPAGGSPDQPTASGRSPPHLHPPPAQLI*GIHQWRHPRRSLSTPAGTGPPG 291 P PAG P P + G +PP PPP P P G PPG Sbjct: 441 PPPPAGPPPPGPPSPGPAPPGARPPPG-----------PPPPGPPPPGPAPPG 482
>SMRC1_MOUSE (P97496) SWI/SNF-related matrix-associated actin-dependent regulator| of chromatin subfamily C member 1 (SWI/SNF complex 155 kDa subunit) (BRG1-associated factor 155) (SWI3-related protein) Length = 1104 Score = 30.4 bits (67), Expect = 3.3 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +1 Query: 142 PAGGSPDQPTASGRSPPHLHPPPAQLI*GIHQWRHPRRSLSTPAGTGPP 288 PA + PT SG +PP + P P ++ PR L+ P G PP Sbjct: 1035 PAVAANIHPTGSGPTPPGMPPMPGNIL-------GPRVPLTAPNGMYPP 1076
>SF01_HUMAN (Q15637) Splicing factor 1 (Zinc finger protein 162) (Transcription| factor ZFM1) (Zinc finger gene in MEN1 locus) (Mammalian branch point-binding protein mBBP) (BBP) Length = 639 Score = 30.0 bits (66), Expect = 4.3 Identities = 23/67 (34%), Positives = 29/67 (43%), Gaps = 12/67 (17%) Frame = +1 Query: 118 GPD*LPHR-PA-----GGSPDQPTASGRSPPHLHPPPAQLI*GIHQWRH------PRRSL 261 GP PH P+ GG P Q +G PP + PPP + G H H + Sbjct: 393 GPHSFPHPLPSLTGGHGGHPMQHNPNGPPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLG 452 Query: 262 STPAGTG 282 STP G+G Sbjct: 453 STPVGSG 459
>SAM68_MOUSE (Q60749) KH domain-containing, RNA-binding, signal| transduction-associated protein 1 (p21 Ras GTPase-activating protein-associated p62) (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p68) Length = 443 Score = 30.0 bits (66), Expect = 4.3 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 121 PD*LPHRPAGGSPDQPTASGRSPPHLHPPP 210 P LPHRP GG P R+ P PPP Sbjct: 37 PSPLPHRPRGGG-GGPRGGARASPATQPPP 65
>SF01_MOUSE (Q64213) Splicing factor 1 (Zinc finger protein 162) (Transcription| factor ZFM1) (mZFM) (Zinc finger gene in MEN1 locus) (Mammalian branch point-binding protein mBBP) (BBP) (CW17) Length = 653 Score = 30.0 bits (66), Expect = 4.3 Identities = 23/67 (34%), Positives = 29/67 (43%), Gaps = 12/67 (17%) Frame = +1 Query: 118 GPD*LPHR-PA-----GGSPDQPTASGRSPPHLHPPPAQLI*GIHQWRH------PRRSL 261 GP PH P+ GG P Q +G PP + PPP + G H H + Sbjct: 393 GPHSFPHPLPSLTGGHGGHPMQHNPNGPPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLG 452 Query: 262 STPAGTG 282 STP G+G Sbjct: 453 STPVGSG 459
>WASF1_HUMAN (Q92558) Wiskott-Aldrich syndrome protein family member 1| (WASP-family protein member 1) (WAVE-1 protein) (Verprolin homology domain-containing protein 1) Length = 559 Score = 29.6 bits (65), Expect = 5.6 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +1 Query: 130 LPHRPAGGSPDQPTASGRSPPHLHP-PPAQLI*GIHQWRHP 249 L H P+G P TA G P + P PP+Q+I RHP Sbjct: 448 LAHPPSGLHPTPSTAPGPHVPLMPPSPPSQVIPASEPKRHP 488
>BAI1_HUMAN (O14514) Brain-specific angiogenesis inhibitor 1 precursor| Length = 1584 Score = 29.3 bits (64), Expect = 7.4 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 142 PAGGSPDQPTASGRSPPHLHPPPAQ 216 P+GG P+ P A PP PPP Q Sbjct: 1399 PSGGPPEAPPAQPPPPPPPPPPPPQ 1423
>WASP_MOUSE (P70315) Wiskott-Aldrich syndrome protein homolog (WASp)| Length = 520 Score = 28.9 bits (63), Expect = 9.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 130 LPHRPAGGSPDQPTASGRSPPHLHPPP 210 LP P GG+P PT G PP PP Sbjct: 359 LPPVPMGGAPPPPTPRGPPPPGRGGPP 385
>DLX2A_BRARE (P50574) Homeobox protein Dlx2a (DLX-2) (Distal-less homeobox gene| 2a) Length = 270 Score = 28.9 bits (63), Expect = 9.6 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +1 Query: 157 PDQPTASGRSPPHLHPPPA 213 P+Q ASG SPPH PP A Sbjct: 189 PEQHVASGESPPHPSPPLA 207
>BRO1_NEUCR (Q7SAN9) Vacuolar protein-sorting protein bro-1 (BRO| domain-containing protein 1) Length = 1012 Score = 28.9 bits (63), Expect = 9.6 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 5/45 (11%) Frame = +1 Query: 130 LPHRPAGG--SPDQ---PTASGRSPPHLHPPPAQLI*GIHQWRHP 249 +PH P G +P Q P++ GR P PPP Q I RHP Sbjct: 841 VPHNPGGQQQTPYQQYNPSSLGRIPGPASPPPNQTSFNIGPGRHP 885
>WASF1_MOUSE (Q8R5H6) Wiskott-Aldrich syndrome protein family member 1| (WASP-family protein member 1) (WAVE-1 protein) Length = 559 Score = 28.9 bits (63), Expect = 9.6 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +1 Query: 130 LPHRPAGGSPDQPTASGRSPPHLHP-PPAQLI*GIHQWRHP 249 L H P+G P TA G P + P PP+Q++ RHP Sbjct: 448 LAHPPSGLHPAPSTAPGPHAPLMPPSPPSQVLPASEPKRHP 488 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,621,217 Number of Sequences: 219361 Number of extensions: 1152203 Number of successful extensions: 3871 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 3226 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3806 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4258037034 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)