| Clone Name | bart38g07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FLIF_AQUAE (O67241) Flagellar M-ring protein | 31 | 2.8 | 2 | RHG26_HUMAN (Q9UNA1) Rho-GTPase-activating protein 26 (Oligophre... | 31 | 2.8 | 3 | TAU_PANTR (Q5YCW1) Microtubule-associated protein tau | 30 | 4.7 | 4 | TAU_HYLLA (Q5YCV9) Microtubule-associated protein tau | 30 | 4.7 | 5 | TAU_GORGO (Q5YCW0) Microtubule-associated protein tau | 30 | 4.7 | 6 | HPAP_RALSO (P35651) HRP-associated protein | 29 | 8.0 | 7 | BNIP3_CAEEL (Q09969) NIP3 homolog (CeBNIP3) | 29 | 8.0 |
|---|
>FLIF_AQUAE (O67241) Flagellar M-ring protein| Length = 489 Score = 30.8 bits (68), Expect = 2.8 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +3 Query: 135 EKKKKPGQTSGRGQWAPWGSSSNAPPTTARQ 227 E+KKK TS R Q P G+ +N PP T RQ Sbjct: 290 EQKKKERTTSTRAQGIP-GTQANIPPATGRQ 319
>RHG26_HUMAN (Q9UNA1) Rho-GTPase-activating protein 26 (Oligophrenin-1-like| protein) (GTPase regulator associated with focal adhesion kinase) Length = 814 Score = 30.8 bits (68), Expect = 2.8 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = +3 Query: 333 KSTEPDLQAPNPVVTPPLANGWQWASRPRPSGPESSKDDVAS 458 K T P+ PNP T PL+ W S P P SS +S Sbjct: 656 KPTRPNSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSS 697
>TAU_PANTR (Q5YCW1) Microtubule-associated protein tau| Length = 775 Score = 30.0 bits (66), Expect = 4.7 Identities = 17/54 (31%), Positives = 25/54 (46%) Frame = +3 Query: 327 QTKSTEPDLQAPNPVVTPPLANGWQWASRPRPSGPESSKDDVASSGLDSEANNP 488 Q +T + P TPP + Q RP P+GP S + + SG S ++P Sbjct: 481 QANATRIPAKTPPAPKTPPSSATKQVQRRPPPAGPRSERGEPPKSGDRSGYSSP 534
>TAU_HYLLA (Q5YCV9) Microtubule-associated protein tau| Length = 775 Score = 30.0 bits (66), Expect = 4.7 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = +3 Query: 327 QTKSTEPDLQAPNPVVTPPLANGWQWASRPRPSGPESSKDDVASSGLDSEANNP 488 Q +T + P TPP + Q RP P+GP+S + + SG S ++P Sbjct: 481 QANATRIPAKTPPAPKTPPSSVTKQVQRRPPPAGPKSERGEPPKSGDRSGYSSP 534
>TAU_GORGO (Q5YCW0) Microtubule-associated protein tau| Length = 775 Score = 30.0 bits (66), Expect = 4.7 Identities = 17/54 (31%), Positives = 25/54 (46%) Frame = +3 Query: 327 QTKSTEPDLQAPNPVVTPPLANGWQWASRPRPSGPESSKDDVASSGLDSEANNP 488 Q +T + P TPP + Q RP P+GP S + + SG S ++P Sbjct: 481 QANATRIPAKTPPAPKTPPSSATKQVQRRPPPAGPRSERGEPPKSGDRSGYSSP 534
>HPAP_RALSO (P35651) HRP-associated protein| Length = 197 Score = 29.3 bits (64), Expect = 8.0 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = +3 Query: 345 PDLQAPNPVVTPPLANGWQWASRPRPSGPESSKDDVASSGLDSEANNPEAE 497 P + P+ TP + + PRP PE +DD D+ A++P E Sbjct: 17 PPTRRRTPLRTPGPHDALPYVPPPRPEPPEPVEDDFPEPRQDTPASDPPPE 67
>BNIP3_CAEEL (Q09969) NIP3 homolog (CeBNIP3)| Length = 210 Score = 29.3 bits (64), Expect = 8.0 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 396 WQWASRPRPSGPESSKDDVASSGLDSEANNPEAE 497 W W+SRP + P++ + S L + N+PE E Sbjct: 128 WDWSSRPENTPPKTVRMVQYGSNLTTPPNSPEPE 161 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,957,890 Number of Sequences: 219361 Number of extensions: 1308633 Number of successful extensions: 4432 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4241 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4427 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4643056080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)