| Clone Name | bart36a09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MCPA_CAUCR (Q00986) Chemoreceptor mcpA (Methyl-accepting chemota... | 29 | 7.1 | 2 | DNAE2_COREF (Q8FRX6) Error-prone DNA polymerase (EC 2.7.7.7) | 29 | 7.1 | 3 | ZN446_HUMAN (Q9NWS9) Zinc finger protein 446 | 28 | 9.2 | 4 | SYS_HUMAN (P49591) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--... | 28 | 9.2 |
|---|
>MCPA_CAUCR (Q00986) Chemoreceptor mcpA (Methyl-accepting chemotaxis protein)| Length = 657 Score = 28.9 bits (63), Expect = 7.1 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = -2 Query: 190 TSAAASD*SSWVRRTALGGPWSSEVVSRTR 101 T+AA + ++ VRRTA G +S+VVS TR Sbjct: 386 TAAALDELTATVRRTAAGARQASDVVSTTR 415
>DNAE2_COREF (Q8FRX6) Error-prone DNA polymerase (EC 2.7.7.7)| Length = 1073 Score = 28.9 bits (63), Expect = 7.1 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 306 GISHHRGAFSGPGEVRDHPAFDVVPTELAR 395 G H G SG + D P DVVPTE AR Sbjct: 525 GQPRHLGIHSGGMVICDRPIADVVPTEWAR 554
>ZN446_HUMAN (Q9NWS9) Zinc finger protein 446| Length = 450 Score = 28.5 bits (62), Expect = 9.2 Identities = 24/98 (24%), Positives = 31/98 (31%), Gaps = 16/98 (16%) Frame = +3 Query: 99 CRVLETTSDDQGPPNAVLLTQDDQSDAAAEVTLPALLTPAVAVDEGVLRLPSHRRP---- 266 CR L + ++ +GPP AA L TPA V G +P+ P Sbjct: 262 CRSLRSGNESEGPPGCPEAQPPQGPGPAAWEGLSGAATPAPTVRPGTPPVPTQPTPAETR 321 Query: 267 ------------CXXXXXXXXXXXXGISHHRGAFSGPG 344 C + HHR SGPG Sbjct: 322 LEPAATPRKPYTCEQCGRGFDWKSVFVIHHRTHTSGPG 359
>SYS_HUMAN (P49591) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 513 Score = 28.5 bits (62), Expect = 9.2 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = +3 Query: 111 ETTSDDQGPPNAVLLTQDDQSDAAAEVTLPALLTPAVAVDEGVLRLPSHR 260 E DD+ P VL D +DA A + + + + +DE +L+ + R Sbjct: 71 EPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAER 120 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,522,437 Number of Sequences: 219361 Number of extensions: 581118 Number of successful extensions: 1750 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1750 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)