| Clone Name | bart36a03 |
|---|---|
| Clone Library Name | barley_pub |
>EMBA_MYCTU (P0A560) Probable arabinosyltransferase A (EC 2.4.2.-)| Length = 1094 Score = 30.0 bits (66), Expect = 4.0 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +3 Query: 150 TAPLSAGRPLVLDLSAPA---ITTPCSGQTTTVTLSANSTD 263 TAPL +G P LD+S P T P +G TL A D Sbjct: 59 TAPLVSGAPRALDISIPCSAIATLPANGGLVLSTLPAGGVD 99
>EMBA_MYCBO (P0A561) Probable arabinosyltransferase A (EC 2.4.2.-)| Length = 1094 Score = 30.0 bits (66), Expect = 4.0 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +3 Query: 150 TAPLSAGRPLVLDLSAPA---ITTPCSGQTTTVTLSANSTD 263 TAPL +G P LD+S P T P +G TL A D Sbjct: 59 TAPLVSGAPRALDISIPCSAIATLPANGGLVLSTLPAGGVD 99
>NFAC1_PIG (O77638) Nuclear factor of activated T-cells, cytoplasmic 1 (NFAT| transcription complex cytosolic component) (NF-ATc1) (NF-ATc) (NFATmac) Length = 822 Score = 29.6 bits (65), Expect = 5.2 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +2 Query: 17 ETQAENGAVQASSGASPARRLHG 85 ET+ GAV+AS+G P+ +LHG Sbjct: 433 ETEGSRGAVKASAGGHPSVQLHG 455
>COAT_GMDNV (Q90125) Coat protein VP1 (Structural protein VP1) [Contains: Coat| protein VP (Structural protein VP2); Coat protein VP3 (Structural protein VP3); Coat protein VP4 (Structural protein VP4)] Length = 811 Score = 29.6 bits (65), Expect = 5.2 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 Query: 195 APAITTPCSGQTTTVTLSANSTDGSNPLS 281 +PA+ TP TT V +++ STD NP S Sbjct: 334 SPAVETPAKKGTTGVNVNSQSTDPQNPSS 362
>FMP1_PSEAE (P17838) Fimbrial protein precursor (Pilin) (Strain P1)| Length = 157 Score = 29.3 bits (64), Expect = 6.8 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +3 Query: 108 LTKITKSGASTALYTAPLSAGRPLVLDLSAPAITTPCSGQTTTVTLSANSTDGS 269 + K+T G TA S G +V + A + TP G+T T+TL N+ GS Sbjct: 85 VAKVTTGG------TAAASGGCTIVATMKASDVATPLRGKTLTLTL-GNADKGS 131
>NFAC1_HUMAN (O95644) Nuclear factor of activated T-cells, cytoplasmic 1 (NFAT| transcription complex cytosolic component) (NF-ATc1) (NF-ATc) Length = 943 Score = 28.9 bits (63), Expect = 8.9 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +2 Query: 17 ETQAENGAVQASSGASPARRLHG 85 ET+ GAV+AS+G P +LHG Sbjct: 443 ETEGSRGAVKASAGGHPIVQLHG 465
>NFAC1_MOUSE (O88942) Nuclear factor of activated T-cells, cytoplasmic 1 (NFAT| transcription complex cytosolic component) (NF-ATc1) (NF-ATc) Length = 717 Score = 28.9 bits (63), Expect = 8.9 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +2 Query: 17 ETQAENGAVQASSGASPARRLHG 85 ET+ GAV+AS+G P +LHG Sbjct: 444 ETEGSRGAVKASAGGHPIVQLHG 466 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,811,847 Number of Sequences: 219361 Number of extensions: 727195 Number of successful extensions: 2780 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2774 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3927707336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)