| Clone Name | bart35c03 |
|---|---|
| Clone Library Name | barley_pub |
>PKD1_HUMAN (P98161) Polycystin-1 precursor (Autosomal dominant polycystic kidney| disease protein 1) Length = 4303 Score = 32.3 bits (72), Expect = 0.97 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -2 Query: 241 MNHLIIAHVYSVMRVDPRGPPRVDVIPRLQALLPDPVGEETH 116 M H+++ +V+ GPPR+ + +AL PDP G H Sbjct: 3727 MAHVLLPYVHGNQSSPELGPPRLRQVRLQEALYPDPPGPRVH 3768
>IF2_DESPS (Q6AJY4) Translation initiation factor IF-2| Length = 939 Score = 31.2 bits (69), Expect = 2.2 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -1 Query: 239 ESPYHRPRIFRDARRPTRPSTSRCDPPPSGSPSRS 135 E P R R R+PTRP +R P + SP+RS Sbjct: 240 ELPIQREEPSRPRRKPTRPPVNRSPRPSTPSPNRS 274
>PDZK4_MOUSE (Q9QY39) PDZ domain-containing protein 4 (PDZ domain-containing| RING finger protein 4-like protein) Length = 772 Score = 30.0 bits (66), Expect = 4.8 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -2 Query: 283 DRSCSDLLVPSSGKMNHLIIAHVYSVMRVDPRGPPRVDVIPRLQALLPDPVGEE 122 D SC DL + SG + H+ ++ ++ P PP + P + + LP P+ E Sbjct: 59 DSSCHDLQLVDSGTQTDITFEHIMALGKLRPPTPPMGILEPYVLSELP-PISHE 111
>PDZK4_HUMAN (Q76G19) PDZ domain-containing protein 4 (PDZ domain-containing| RING finger protein 4-like protein) Length = 769 Score = 29.6 bits (65), Expect = 6.3 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = -2 Query: 283 DRSCSDLLVPSSGKMNHLIIAHVYSVMRVDPRGPPRVDVIPRLQALLPDPVGEE 122 D SC DL + SG + H+ ++ ++ P PP V L P P+ E Sbjct: 59 DSSCHDLQLVDSGTQTDITFEHIMALGKLRPPTPPMV-------ILEPPPISHE 105
>MAST2_MOUSE (Q60592) Microtubule-associated serine/threonine-protein kinase 2 (EC| 2.7.11.1) Length = 1734 Score = 29.6 bits (65), Expect = 6.3 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -1 Query: 224 RPRIFRDARRPTR-PSTSRCDPPPSGSPSRSCWR 126 RP+ F +A P + PS SR P S +PS CW+ Sbjct: 1523 RPQAFEEATNPLQVPSLSRSGPT-SPTPSEGCWK 1555
>AEGP_RAT (Q63191) Apical endosomal glycoprotein precursor| Length = 1216 Score = 29.6 bits (65), Expect = 6.3 Identities = 20/66 (30%), Positives = 28/66 (42%) Frame = +2 Query: 155 KAGDHIYSWRAAWVYAHHGIYVGDDKVIHFTRGRDQEVGTGTVIDFLLVSSGPNRSSTPC 334 ++G H W AWV HH + + F RD GT +D + V GP ++ C Sbjct: 759 RSGTHGNRWHQAWVTLHHQLQPSTKYQLLFEGLRDGYHGT-MGLDDMAVRPGPCWAAKRC 817 Query: 335 LVCSSD 352 SD Sbjct: 818 SFEDSD 823
>UN112_DROME (Q9VZI3) Unc-112-related protein (Fermitin-1)| Length = 708 Score = 29.3 bits (64), Expect = 8.2 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 116 MGLLSNRIGKESLKAGDHIYSWR 184 +G+ +NRI + L GDHI +WR Sbjct: 615 LGVANNRIMRMDLNTGDHIKTWR 637 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,806,174 Number of Sequences: 219361 Number of extensions: 1611116 Number of successful extensions: 5100 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4846 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5097 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4757699440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)