| Clone Name | bart34g02 |
|---|---|
| Clone Library Name | barley_pub |
>ZN496_HUMAN (Q96IT1) Zinc finger protein 496| Length = 587 Score = 32.7 bits (73), Expect = 0.73 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = -1 Query: 512 RGARAHSPHVSPFRVWSLRGGWLKLFWHTLDPVLHLLVDE 393 R A P + R+W L GGWL+ HT + +L LLV E Sbjct: 49 RYQEAAGPREALQRLWDLCGGWLRPERHTKEQILELLVLE 88
>PDR8_YEAST (Q06149) Transcription factor PDR8 (Pleiotropic drug resistance| protein 8) Length = 701 Score = 31.2 bits (69), Expect = 2.1 Identities = 18/53 (33%), Positives = 29/53 (54%) Frame = +3 Query: 270 RFLDVVERYFARSDDSKRLQERPHLHYQVGVTPEGVEVPRSLVDKEMQDRIKS 428 RF ++++ FA ++ +KRL + YQ+ T V R L DK Q RI++ Sbjct: 596 RFYEIIDSIFAVNERNKRLLKAVSNFYQLTSTLAFERVSRVLFDKASQARIET 648
>NBEA_HUMAN (Q8NFP9) Protein neurobeachin (Lysosomal trafficking regulator 2)| (Protein BCL8B) Length = 2946 Score = 30.8 bits (68), Expect = 2.8 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = -1 Query: 509 GARAHSPHVSPFRVWSLRGGWLKLFWHTLDPVLHLLVDEAARYLHAFR 366 G A + + P W + G+ W +DP+ ++ VD+ YL+ FR Sbjct: 237 GCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNNINVDKDKPYLYCFR 284
>NBEA_MOUSE (Q9EPN1) Protein neurobeachin (Lysosomal trafficking regulator 2)| Length = 2936 Score = 30.8 bits (68), Expect = 2.8 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = -1 Query: 509 GARAHSPHVSPFRVWSLRGGWLKLFWHTLDPVLHLLVDEAARYLHAFR 366 G A + + P W + G+ W +DP+ ++ VD+ YL+ FR Sbjct: 227 GCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNNINVDKDKPYLYCFR 274
>LRBA_HUMAN (P50851) Lipopolysaccharide-responsive and beige-like anchor| protein (CDC4-like protein) (Beige-like protein) Length = 2863 Score = 30.4 bits (67), Expect = 3.6 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -1 Query: 509 GARAHSPHVSPFRVWSLRGGWLKLFWHTLDPVLHLLVDEAARYLHAFR 366 G A + + P W + G+ W +DPV ++ VD+ YL+ FR Sbjct: 211 GKSAAAIALPPIAKWPYQNGFTFHTWLRMDPVNNINVDKDKPYLYCFR 258
>NCKX_DROME (Q9U6A0) Sodium/potassium/calcium exchanger| (Na(+)/K(+)/Ca(2+)-exchange protein) Length = 856 Score = 29.3 bits (64), Expect = 8.1 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -1 Query: 458 RGGWLKLFWHTLDPVLHLLVDEAARYLHA 372 R G L+L HT+DP+ VDE A LHA Sbjct: 569 RHGLLQLMIHTIDPLHDGKVDEKATQLHA 597 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,976,572 Number of Sequences: 219361 Number of extensions: 1082762 Number of successful extensions: 3626 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3613 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4700377760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)