| Clone Name | bart34b05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NUDC_RAT (Q63525) Nuclear migration protein nudC (Nuclear distri... | 39 | 0.013 | 2 | NUDC_HUMAN (Q9Y266) Nuclear migration protein nudC (Nuclear dist... | 39 | 0.013 | 3 | NUDC_CHICK (Q5ZIN1) Nuclear migration protein nudC (Nuclear dist... | 38 | 0.022 | 4 | NUDC_MOUSE (O35685) Nuclear migration protein nudC (Nuclear dist... | 37 | 0.028 | 5 | GLIS1_HUMAN (Q8NBF1) Zinc finger protein GLIS1 (GLI-similar 1) | 29 | 7.8 |
|---|
>NUDC_RAT (Q63525) Nuclear migration protein nudC (Nuclear distribution| protein C homolog) (c15) Length = 332 Score = 38.5 bits (88), Expect = 0.013 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +3 Query: 462 EVEKEEGKANKPNAGNGLDMEKYSWTQQLS 551 E EK++GK KPN GNG D+ Y WTQ LS Sbjct: 152 EDEKDKGKL-KPNLGNGADLPNYRWTQTLS 180
>NUDC_HUMAN (Q9Y266) Nuclear migration protein nudC (Nuclear distribution| protein C homolog) Length = 331 Score = 38.5 bits (88), Expect = 0.013 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +3 Query: 462 EVEKEEGKANKPNAGNGLDMEKYSWTQQLS 551 E EK++GK KPN GNG D+ Y WTQ LS Sbjct: 151 EDEKDKGKL-KPNLGNGADLPNYRWTQTLS 179
>NUDC_CHICK (Q5ZIN1) Nuclear migration protein nudC (Nuclear distribution| protein C homolog) Length = 341 Score = 37.7 bits (86), Expect = 0.022 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = +3 Query: 468 EKEEGKANKPNAGNGLDMEKYSWTQQLS 551 E ++GK KPNAGNG D+ Y WTQ LS Sbjct: 163 ENDKGKL-KPNAGNGADLPNYRWTQTLS 189
>NUDC_MOUSE (O35685) Nuclear migration protein nudC (Nuclear distribution| protein C homolog) (Silica-induced gene 92 protein) (SIG-92) Length = 332 Score = 37.4 bits (85), Expect = 0.028 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = +3 Query: 462 EVEKEEGKANKPNAGNGLDMEKYSWTQQLS 551 E EK++GK KPN GNG D+ Y WTQ L+ Sbjct: 152 EDEKDKGKL-KPNLGNGADLPNYRWTQTLA 180
>GLIS1_HUMAN (Q8NBF1) Zinc finger protein GLIS1 (GLI-similar 1)| Length = 620 Score = 29.3 bits (64), Expect = 7.8 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 529 YFSISRPLPAFGLFALPSSFSTSVLPPRPS 440 Y S+S PLPA G AL + + LP +PS Sbjct: 558 YHSLSTPLPATGYEALAEASCPTALPQQPS 587 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,734,354 Number of Sequences: 219361 Number of extensions: 343454 Number of successful extensions: 1352 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1302 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1352 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4488201198 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)